Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9GKE9

Protein Details
Accession K9GKE9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIKSNKKKAAKAKAAAKKKTHydrophilic
NLS Segment(s)
PositionSequence
73-89SNKKKAAKAKAAAKKKT
Subcellular Location(s) plas 16, E.R. 4, mito 3, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLGQFVGSVMLLVATAIFLYYTAWTLLMPFVDPGHPLHDIFPPRVWAIRIPVILTLLGSAVVGTFIGIVMIKSNKKKAAKAKAAAKKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.1
22 0.11
23 0.11
24 0.12
25 0.15
26 0.17
27 0.17
28 0.17
29 0.16
30 0.16
31 0.16
32 0.16
33 0.12
34 0.14
35 0.16
36 0.16
37 0.15
38 0.14
39 0.14
40 0.13
41 0.12
42 0.09
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.06
57 0.1
58 0.15
59 0.2
60 0.25
61 0.33
62 0.38
63 0.45
64 0.53
65 0.6
66 0.65
67 0.7
68 0.75
69 0.78