Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FPZ6

Protein Details
Accession K9FPZ6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MGPRRSHRKSRNGCPQCKARRIKCDEQCPCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MGPRRSHRKSRNGCPQCKARRIKCDEQCPCTNCTKHAIHCSYVDSGMSNSTHTRYTQSESLEPSYVPSTLNVEYYPATPAGNFDVHNVRGVCGVREDRRKDDPLDCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.83
4 0.83
5 0.82
6 0.79
7 0.8
8 0.81
9 0.84
10 0.82
11 0.83
12 0.81
13 0.78
14 0.77
15 0.69
16 0.64
17 0.61
18 0.54
19 0.44
20 0.43
21 0.4
22 0.37
23 0.43
24 0.42
25 0.37
26 0.37
27 0.37
28 0.31
29 0.28
30 0.23
31 0.14
32 0.12
33 0.11
34 0.1
35 0.09
36 0.08
37 0.09
38 0.1
39 0.1
40 0.13
41 0.13
42 0.16
43 0.18
44 0.19
45 0.2
46 0.22
47 0.23
48 0.21
49 0.19
50 0.17
51 0.15
52 0.13
53 0.12
54 0.1
55 0.11
56 0.11
57 0.12
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.1
64 0.09
65 0.08
66 0.09
67 0.11
68 0.12
69 0.12
70 0.13
71 0.18
72 0.19
73 0.24
74 0.23
75 0.2
76 0.23
77 0.23
78 0.21
79 0.21
80 0.28
81 0.31
82 0.4
83 0.45
84 0.48
85 0.54
86 0.58
87 0.57