Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9G1Y8

Protein Details
Accession K9G1Y8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-81HDDHHHRRRHHHHHHYSHRSHSSBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MDRGLGGSLAGGVAGYYLGHEKEHGLLGAIGGALLGNFLEDKVKDLKKHDDVSEHENDHDDHHHRRRHHHHHHYSHRSHSSQSSHSGHTDHSGHFHSSRHTSHSRHHHKGEHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.05
5 0.06
6 0.07
7 0.07
8 0.08
9 0.1
10 0.11
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.07
17 0.06
18 0.04
19 0.04
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.03
26 0.04
27 0.04
28 0.07
29 0.13
30 0.16
31 0.18
32 0.22
33 0.29
34 0.33
35 0.37
36 0.36
37 0.35
38 0.35
39 0.38
40 0.39
41 0.33
42 0.27
43 0.25
44 0.24
45 0.2
46 0.21
47 0.18
48 0.21
49 0.28
50 0.33
51 0.34
52 0.43
53 0.52
54 0.6
55 0.68
56 0.72
57 0.75
58 0.8
59 0.89
60 0.89
61 0.83
62 0.8
63 0.75
64 0.66
65 0.58
66 0.53
67 0.47
68 0.4
69 0.43
70 0.38
71 0.34
72 0.34
73 0.33
74 0.28
75 0.28
76 0.28
77 0.21
78 0.21
79 0.22
80 0.24
81 0.24
82 0.25
83 0.25
84 0.28
85 0.3
86 0.34
87 0.37
88 0.38
89 0.45
90 0.55
91 0.61
92 0.64
93 0.69
94 0.69