Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9GFQ8

Protein Details
Accession K9GFQ8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-30DTIKLHRQLRRLDRRVRERPEEEBasic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
IPR019972  Ribosomal_L14P_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
PROSITE View protein in PROSITE  
PS00049  RIBOSOMAL_L14  
Amino Acid Sequences MLTLAPPDTIKLHRQLRRLDRRVRERPEEEAARDNRSVSTALEPSTQHSKKGDRIVVVVQKQRSAGSEATTAAALASKVRRGDIRHAVVVRVKKELQRPDGSLVRFGDNACVLVNKSGDPIGTRMNGVVGQELRNKKWSKILSLAPIHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.65
4 0.72
5 0.77
6 0.78
7 0.79
8 0.83
9 0.87
10 0.85
11 0.83
12 0.75
13 0.72
14 0.7
15 0.65
16 0.57
17 0.56
18 0.5
19 0.45
20 0.43
21 0.38
22 0.3
23 0.26
24 0.24
25 0.17
26 0.18
27 0.15
28 0.16
29 0.17
30 0.17
31 0.19
32 0.29
33 0.28
34 0.26
35 0.28
36 0.3
37 0.34
38 0.41
39 0.4
40 0.31
41 0.33
42 0.36
43 0.39
44 0.39
45 0.38
46 0.32
47 0.3
48 0.29
49 0.28
50 0.24
51 0.21
52 0.16
53 0.14
54 0.14
55 0.13
56 0.13
57 0.12
58 0.11
59 0.07
60 0.07
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.09
67 0.12
68 0.14
69 0.21
70 0.27
71 0.3
72 0.31
73 0.32
74 0.32
75 0.34
76 0.35
77 0.3
78 0.26
79 0.24
80 0.25
81 0.32
82 0.37
83 0.4
84 0.4
85 0.41
86 0.43
87 0.46
88 0.43
89 0.4
90 0.34
91 0.3
92 0.26
93 0.24
94 0.21
95 0.16
96 0.16
97 0.12
98 0.11
99 0.1
100 0.11
101 0.12
102 0.09
103 0.1
104 0.1
105 0.11
106 0.11
107 0.13
108 0.14
109 0.15
110 0.15
111 0.14
112 0.15
113 0.15
114 0.14
115 0.17
116 0.14
117 0.17
118 0.24
119 0.29
120 0.3
121 0.38
122 0.4
123 0.38
124 0.45
125 0.47
126 0.46
127 0.48
128 0.52
129 0.53