Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9FRR9

Protein Details
Accession K9FRR9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-156RNETRREAKKHPRKDWQDRAEKVBasic
239-259EDEMESRRKRWENRHDRIWSRBasic
NLS Segment(s)
PositionSequence
107-168NNHKRHPKDQRRDPDNTGRTDRERRAFRNETRREAKKHPRKDWQDRAEKVKQISENKGKRKP
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MATKCAASSRPALPAVLRNVFRSQFFNDSGASSVIPHHRPLAFGRLFISNIQLQQSFSSMARLCDPSSESALAAPETPAVADDIVSLQDKIPKKRDYDSDGKKGVLNNHKRHPKDQRRDPDNTGRTDRERRAFRNETRREAKKHPRKDWQDRAEKVKQISENKGKRKPETWQVQKAALKEKFAGGWNPPKKLSPDALDGIRHLHAKAPEQFTTAVLAEEFEMSPEAIRRILKSKWRPSEDEMESRRKRWENRHDRIWSRMAELGLRPSTNRTRTLSDFHVLYDDNNRERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.39
4 0.38
5 0.36
6 0.4
7 0.41
8 0.41
9 0.38
10 0.36
11 0.34
12 0.34
13 0.33
14 0.28
15 0.27
16 0.27
17 0.24
18 0.19
19 0.14
20 0.16
21 0.21
22 0.22
23 0.23
24 0.25
25 0.25
26 0.27
27 0.29
28 0.34
29 0.29
30 0.28
31 0.28
32 0.26
33 0.27
34 0.25
35 0.26
36 0.18
37 0.19
38 0.21
39 0.19
40 0.18
41 0.17
42 0.18
43 0.17
44 0.14
45 0.19
46 0.17
47 0.17
48 0.2
49 0.21
50 0.2
51 0.2
52 0.22
53 0.18
54 0.2
55 0.2
56 0.16
57 0.15
58 0.16
59 0.14
60 0.13
61 0.1
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.07
75 0.13
76 0.18
77 0.23
78 0.3
79 0.33
80 0.36
81 0.41
82 0.46
83 0.48
84 0.54
85 0.56
86 0.57
87 0.55
88 0.53
89 0.49
90 0.46
91 0.47
92 0.46
93 0.48
94 0.46
95 0.53
96 0.61
97 0.61
98 0.66
99 0.7
100 0.71
101 0.71
102 0.75
103 0.77
104 0.75
105 0.78
106 0.77
107 0.76
108 0.7
109 0.63
110 0.58
111 0.5
112 0.49
113 0.5
114 0.49
115 0.46
116 0.47
117 0.46
118 0.51
119 0.55
120 0.57
121 0.61
122 0.61
123 0.61
124 0.63
125 0.65
126 0.62
127 0.64
128 0.68
129 0.67
130 0.71
131 0.71
132 0.74
133 0.78
134 0.83
135 0.84
136 0.82
137 0.81
138 0.75
139 0.75
140 0.7
141 0.64
142 0.55
143 0.49
144 0.45
145 0.4
146 0.45
147 0.47
148 0.49
149 0.54
150 0.6
151 0.6
152 0.58
153 0.56
154 0.54
155 0.54
156 0.56
157 0.57
158 0.58
159 0.57
160 0.6
161 0.59
162 0.56
163 0.56
164 0.46
165 0.39
166 0.31
167 0.29
168 0.25
169 0.24
170 0.24
171 0.19
172 0.28
173 0.3
174 0.32
175 0.32
176 0.33
177 0.34
178 0.35
179 0.35
180 0.28
181 0.29
182 0.29
183 0.3
184 0.29
185 0.26
186 0.25
187 0.23
188 0.2
189 0.16
190 0.17
191 0.16
192 0.22
193 0.28
194 0.3
195 0.29
196 0.3
197 0.31
198 0.27
199 0.28
200 0.22
201 0.16
202 0.11
203 0.11
204 0.09
205 0.1
206 0.09
207 0.06
208 0.07
209 0.07
210 0.07
211 0.08
212 0.09
213 0.1
214 0.12
215 0.14
216 0.18
217 0.24
218 0.33
219 0.42
220 0.52
221 0.59
222 0.64
223 0.67
224 0.67
225 0.72
226 0.67
227 0.67
228 0.62
229 0.63
230 0.61
231 0.58
232 0.61
233 0.59
234 0.61
235 0.62
236 0.68
237 0.68
238 0.74
239 0.82
240 0.83
241 0.8
242 0.78
243 0.74
244 0.64
245 0.56
246 0.51
247 0.42
248 0.36
249 0.33
250 0.34
251 0.31
252 0.3
253 0.27
254 0.3
255 0.38
256 0.39
257 0.43
258 0.4
259 0.44
260 0.47
261 0.52
262 0.5
263 0.46
264 0.42
265 0.37
266 0.36
267 0.3
268 0.28
269 0.3
270 0.32