Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9GCK3

Protein Details
Accession K9GCK3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
110-129LDWRSKCSSKYCRPERVSAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6.5, cyto_nucl 6.5, nucl 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025340  DUF4246  
Pfam View protein in Pfam  
PF14033  DUF4246  
Amino Acid Sequences MTTAMNRWTDLPNWHVDVFTGVVVARWRRDSATCIGMKPLLSDRAWAWCGRELRDKANEWCQKRSIQVVNTGSCVCQSDPVTALRTGELAGEFQRAVLPVLRTLMQSGLLDWRSKCSSKYCRPERVSAGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.24
4 0.23
5 0.2
6 0.16
7 0.12
8 0.08
9 0.09
10 0.12
11 0.14
12 0.15
13 0.17
14 0.18
15 0.19
16 0.21
17 0.24
18 0.25
19 0.3
20 0.29
21 0.27
22 0.28
23 0.27
24 0.25
25 0.23
26 0.22
27 0.18
28 0.17
29 0.18
30 0.17
31 0.2
32 0.21
33 0.2
34 0.19
35 0.2
36 0.22
37 0.23
38 0.31
39 0.28
40 0.31
41 0.36
42 0.37
43 0.35
44 0.43
45 0.47
46 0.42
47 0.43
48 0.41
49 0.37
50 0.36
51 0.38
52 0.32
53 0.27
54 0.31
55 0.31
56 0.3
57 0.3
58 0.28
59 0.23
60 0.19
61 0.19
62 0.11
63 0.12
64 0.12
65 0.12
66 0.13
67 0.15
68 0.17
69 0.16
70 0.16
71 0.12
72 0.12
73 0.11
74 0.1
75 0.08
76 0.07
77 0.07
78 0.08
79 0.08
80 0.07
81 0.08
82 0.08
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.14
89 0.13
90 0.14
91 0.13
92 0.12
93 0.11
94 0.11
95 0.16
96 0.17
97 0.2
98 0.19
99 0.24
100 0.27
101 0.29
102 0.3
103 0.34
104 0.43
105 0.5
106 0.61
107 0.65
108 0.71
109 0.75
110 0.8