Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q59TA8

Protein Details
Accession Q59TA8    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTNLPLKEVKRQLRKQLKSNLKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002698  FTHF_cligase  
IPR024185  FTHF_cligase-like_sf  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:0005829  C:cytosol  
GO:0005739  C:mitochondrion  
GO:0030272  F:5-formyltetrahydrofolate cyclo-ligase activity  
GO:0005524  F:ATP binding  
GO:0046872  F:metal ion binding  
GO:0009396  P:folic acid-containing compound biosynthetic process  
GO:0035999  P:tetrahydrofolate interconversion  
KEGG cal:CAALFM_C102020WA  -  
Pfam View protein in Pfam  
PF01812  5-FTHF_cyc-lig  
Amino Acid Sequences MTNLPLKEVKRQLRKQLKSNLKTITQDSLIKQSHLIHQNLLNHEFFKTANNIAVFMNMPDSEVKTMEIIESCFKLGKSVYLPRCNYVSSPGRKSNYMSLLEMPSLEAIHQLKPQGKYQLLEPLTGNDAIETGILDLIIVPGVAFDKNKNRMGHGAGFYDEFITTFHNKFKRKPYLLGVALQEQIVDYIPTEPHDWKLDSIITSTNVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.85
5 0.79
6 0.79
7 0.74
8 0.68
9 0.64
10 0.58
11 0.52
12 0.45
13 0.44
14 0.39
15 0.41
16 0.37
17 0.34
18 0.33
19 0.3
20 0.34
21 0.38
22 0.37
23 0.31
24 0.33
25 0.39
26 0.41
27 0.41
28 0.34
29 0.27
30 0.27
31 0.24
32 0.2
33 0.17
34 0.16
35 0.14
36 0.17
37 0.17
38 0.17
39 0.16
40 0.17
41 0.15
42 0.12
43 0.13
44 0.09
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.1
63 0.11
64 0.14
65 0.23
66 0.29
67 0.36
68 0.37
69 0.37
70 0.39
71 0.37
72 0.33
73 0.31
74 0.32
75 0.3
76 0.35
77 0.39
78 0.39
79 0.4
80 0.41
81 0.39
82 0.36
83 0.33
84 0.27
85 0.23
86 0.22
87 0.21
88 0.19
89 0.14
90 0.09
91 0.07
92 0.06
93 0.07
94 0.07
95 0.08
96 0.09
97 0.12
98 0.16
99 0.18
100 0.21
101 0.23
102 0.23
103 0.22
104 0.23
105 0.29
106 0.26
107 0.25
108 0.22
109 0.19
110 0.19
111 0.19
112 0.17
113 0.08
114 0.08
115 0.06
116 0.06
117 0.05
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.02
127 0.02
128 0.03
129 0.04
130 0.05
131 0.08
132 0.16
133 0.23
134 0.29
135 0.3
136 0.32
137 0.34
138 0.38
139 0.41
140 0.35
141 0.31
142 0.26
143 0.25
144 0.23
145 0.21
146 0.16
147 0.1
148 0.08
149 0.11
150 0.13
151 0.14
152 0.21
153 0.27
154 0.31
155 0.38
156 0.48
157 0.55
158 0.56
159 0.61
160 0.61
161 0.64
162 0.62
163 0.6
164 0.53
165 0.45
166 0.41
167 0.35
168 0.28
169 0.18
170 0.16
171 0.12
172 0.09
173 0.07
174 0.08
175 0.09
176 0.11
177 0.14
178 0.15
179 0.18
180 0.23
181 0.24
182 0.23
183 0.26
184 0.26
185 0.25
186 0.25
187 0.24