Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RJ15

Protein Details
Accession E3RJ15    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVSTGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-21GKKQKKKWSKGKVKDK
Subcellular Location(s) mito 10cyto 10cyto_mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pte:PTT_08092  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVSTGGKKQKKKWSKGKVKDKAQHAVVLDKQTNDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEANGQIKKVVGHSKLSIYTRAVGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.93
4 0.93
5 0.93
6 0.9
7 0.86
8 0.82
9 0.73
10 0.66
11 0.55
12 0.5
13 0.43
14 0.41
15 0.35
16 0.28
17 0.28
18 0.26
19 0.3
20 0.28
21 0.26
22 0.24
23 0.26
24 0.3
25 0.33
26 0.34
27 0.33
28 0.35
29 0.33
30 0.31
31 0.28
32 0.23
33 0.18
34 0.16
35 0.13
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.12
46 0.14
47 0.15
48 0.16
49 0.17
50 0.16
51 0.15
52 0.16
53 0.14
54 0.12
55 0.1
56 0.13
57 0.16
58 0.17
59 0.17
60 0.16
61 0.15
62 0.14
63 0.14
64 0.16
65 0.19
66 0.2
67 0.25
68 0.27
69 0.31
70 0.36
71 0.38
72 0.37
73 0.31
74 0.31
75 0.28