Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K9G5B9

Protein Details
Accession K9G5B9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107KGRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFSLRAVFGASSGALRQFLPSVTTRTASLRPFSHLIYNSLTRLRGQVQSGNVVAVANGSARQVEQLRGMKTRSSVKRLCDGCKPVHRKGRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.1
6 0.13
7 0.14
8 0.17
9 0.18
10 0.19
11 0.19
12 0.22
13 0.26
14 0.25
15 0.28
16 0.25
17 0.27
18 0.28
19 0.28
20 0.29
21 0.26
22 0.26
23 0.26
24 0.26
25 0.24
26 0.23
27 0.23
28 0.18
29 0.18
30 0.18
31 0.17
32 0.17
33 0.19
34 0.18
35 0.2
36 0.19
37 0.17
38 0.15
39 0.12
40 0.1
41 0.06
42 0.05
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.06
49 0.07
50 0.08
51 0.13
52 0.18
53 0.2
54 0.22
55 0.23
56 0.23
57 0.25
58 0.34
59 0.34
60 0.37
61 0.39
62 0.4
63 0.48
64 0.5
65 0.51
66 0.5
67 0.49
68 0.5
69 0.56
70 0.59
71 0.6
72 0.65
73 0.67
74 0.63
75 0.64
76 0.68
77 0.63
78 0.61
79 0.62
80 0.6
81 0.63
82 0.66
83 0.66
84 0.66
85 0.71
86 0.77
87 0.78