Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S7C1

Protein Details
Accession E3S7C1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-105LGKLQNKPKKGEKLKPPSPAETHydrophilic
NLS Segment(s)
PositionSequence
90-98KPKKGEKLK
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
KEGG pte:PTT_18710  -  
Amino Acid Sequences MVWNLGVLSTDHVGASGAEPPPPYTCIYFYAVSYKLGTAKISTSNCFKYKALNLTGTEMCSFTGLPDCPQEKKFDRICYIRALLGKLQNKPKKGEKLKPPSPAETPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.11
5 0.12
6 0.12
7 0.14
8 0.15
9 0.17
10 0.18
11 0.15
12 0.17
13 0.19
14 0.22
15 0.21
16 0.2
17 0.22
18 0.22
19 0.21
20 0.2
21 0.17
22 0.15
23 0.15
24 0.15
25 0.11
26 0.12
27 0.17
28 0.18
29 0.19
30 0.21
31 0.25
32 0.26
33 0.29
34 0.27
35 0.25
36 0.28
37 0.31
38 0.29
39 0.28
40 0.27
41 0.28
42 0.28
43 0.25
44 0.21
45 0.16
46 0.13
47 0.1
48 0.09
49 0.06
50 0.09
51 0.09
52 0.09
53 0.14
54 0.16
55 0.19
56 0.2
57 0.26
58 0.26
59 0.34
60 0.38
61 0.4
62 0.44
63 0.45
64 0.46
65 0.45
66 0.43
67 0.39
68 0.35
69 0.31
70 0.29
71 0.34
72 0.37
73 0.38
74 0.47
75 0.5
76 0.52
77 0.56
78 0.61
79 0.64
80 0.69
81 0.72
82 0.72
83 0.77
84 0.82
85 0.85
86 0.81
87 0.76