Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K9G8S3

Protein Details
Accession K9G8S3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-99PITGPAAKPRVRKRKKKKPREKTLFPRNFRNFRNBasic
NLS Segment(s)
PositionSequence
71-87AAKPRVRKRKKKKPREK
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MRKSRPTCKTMNMEIQNDTKWVNSRAWAKWVQFDPKLEGGKEENQKGMPETIRSTQYYERRQHLAPITGPAAKPRVRKRKKKKPREKTLFPRNFRNFRNLCIFWHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.48
4 0.41
5 0.34
6 0.27
7 0.24
8 0.23
9 0.2
10 0.23
11 0.28
12 0.29
13 0.34
14 0.37
15 0.34
16 0.38
17 0.41
18 0.42
19 0.39
20 0.39
21 0.37
22 0.37
23 0.38
24 0.31
25 0.29
26 0.26
27 0.3
28 0.33
29 0.3
30 0.26
31 0.25
32 0.25
33 0.24
34 0.23
35 0.17
36 0.14
37 0.15
38 0.16
39 0.18
40 0.18
41 0.2
42 0.24
43 0.3
44 0.37
45 0.39
46 0.4
47 0.41
48 0.4
49 0.42
50 0.4
51 0.36
52 0.29
53 0.27
54 0.26
55 0.24
56 0.24
57 0.21
58 0.23
59 0.24
60 0.31
61 0.38
62 0.48
63 0.56
64 0.67
65 0.77
66 0.83
67 0.9
68 0.94
69 0.95
70 0.95
71 0.96
72 0.96
73 0.95
74 0.95
75 0.95
76 0.94
77 0.88
78 0.88
79 0.86
80 0.84
81 0.76
82 0.75
83 0.66
84 0.61
85 0.65
86 0.56