Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KMC9

Protein Details
Accession K0KMC9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
182-219KDDSAEEKKRQQKAKKRAEQREKKQREKQLQEEQERKQBasic
NLS Segment(s)
PositionSequence
189-209KKRQQKAKKRAEQREKKQREK
Subcellular Location(s) nucl 16, cyto_nucl 12.833, mito_nucl 9.833, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MSNKTIKDTLEALSHMASILYRGLGYQQLTQKKDGNSIITEFSGDRRVIVLWVMNDDYAIIYNKDAQVHTVEVQQDWFLKGVKFPISPEELDEIALDEKKQFGKTFIGYAFSIIGEIPENLKSNASGSEELKLVNTKLIQGQQTFEKTGKLPTFTDKEVNLLLYKIVKPKLAGELLFPPELKDDSAEEKKRQQKAKKRAEQREKKQREKQLQEEQERKQEEERKLDKYPIYTPRPLSGFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.13
4 0.11
5 0.08
6 0.08
7 0.07
8 0.06
9 0.07
10 0.08
11 0.12
12 0.13
13 0.18
14 0.25
15 0.32
16 0.35
17 0.39
18 0.43
19 0.41
20 0.46
21 0.43
22 0.39
23 0.34
24 0.33
25 0.32
26 0.26
27 0.26
28 0.2
29 0.19
30 0.19
31 0.17
32 0.15
33 0.14
34 0.14
35 0.13
36 0.14
37 0.14
38 0.1
39 0.13
40 0.13
41 0.12
42 0.11
43 0.11
44 0.1
45 0.09
46 0.1
47 0.08
48 0.07
49 0.1
50 0.12
51 0.14
52 0.14
53 0.13
54 0.14
55 0.15
56 0.16
57 0.17
58 0.16
59 0.15
60 0.15
61 0.15
62 0.14
63 0.12
64 0.12
65 0.1
66 0.1
67 0.1
68 0.13
69 0.15
70 0.15
71 0.15
72 0.17
73 0.19
74 0.19
75 0.2
76 0.19
77 0.16
78 0.16
79 0.15
80 0.12
81 0.1
82 0.11
83 0.09
84 0.07
85 0.08
86 0.09
87 0.11
88 0.1
89 0.12
90 0.14
91 0.15
92 0.18
93 0.16
94 0.18
95 0.16
96 0.16
97 0.14
98 0.11
99 0.1
100 0.07
101 0.07
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.08
108 0.08
109 0.08
110 0.08
111 0.09
112 0.1
113 0.11
114 0.1
115 0.12
116 0.12
117 0.12
118 0.12
119 0.11
120 0.09
121 0.09
122 0.09
123 0.08
124 0.1
125 0.13
126 0.15
127 0.14
128 0.16
129 0.18
130 0.2
131 0.2
132 0.18
133 0.17
134 0.16
135 0.21
136 0.21
137 0.2
138 0.19
139 0.23
140 0.26
141 0.26
142 0.29
143 0.23
144 0.23
145 0.22
146 0.22
147 0.17
148 0.13
149 0.13
150 0.12
151 0.14
152 0.17
153 0.18
154 0.18
155 0.18
156 0.2
157 0.24
158 0.24
159 0.23
160 0.2
161 0.24
162 0.26
163 0.26
164 0.24
165 0.19
166 0.18
167 0.19
168 0.17
169 0.13
170 0.12
171 0.19
172 0.28
173 0.32
174 0.34
175 0.42
176 0.5
177 0.57
178 0.64
179 0.67
180 0.69
181 0.75
182 0.83
183 0.84
184 0.87
185 0.9
186 0.92
187 0.93
188 0.93
189 0.94
190 0.93
191 0.93
192 0.92
193 0.91
194 0.9
195 0.89
196 0.87
197 0.87
198 0.87
199 0.86
200 0.85
201 0.8
202 0.78
203 0.71
204 0.64
205 0.61
206 0.6
207 0.57
208 0.6
209 0.59
210 0.57
211 0.57
212 0.61
213 0.57
214 0.53
215 0.54
216 0.53
217 0.55
218 0.55
219 0.55
220 0.55