Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KY71

Protein Details
Accession K0KY71   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-123FWCSKIKTSNDCKTKKKKLDYAPLWACHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, E.R. 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKLSTTVLVQTGLLLSCVTASSVTFTPDAAPDALESPKGDNSTDGLVGAEGYNTIYNLCFDANKSKYCYKNSVKGCAAVYKHEDKLTDYEATTICSFWCSKIKTSNDCKTKKKKLDYAPLWACDDQKYCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.08
9 0.09
10 0.11
11 0.11
12 0.11
13 0.12
14 0.12
15 0.14
16 0.1
17 0.1
18 0.09
19 0.11
20 0.11
21 0.11
22 0.11
23 0.11
24 0.13
25 0.14
26 0.13
27 0.12
28 0.13
29 0.13
30 0.13
31 0.11
32 0.09
33 0.08
34 0.08
35 0.07
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.14
49 0.16
50 0.18
51 0.22
52 0.27
53 0.31
54 0.34
55 0.42
56 0.38
57 0.45
58 0.46
59 0.49
60 0.45
61 0.43
62 0.41
63 0.37
64 0.34
65 0.28
66 0.29
67 0.26
68 0.27
69 0.25
70 0.25
71 0.22
72 0.24
73 0.24
74 0.21
75 0.17
76 0.17
77 0.16
78 0.18
79 0.17
80 0.14
81 0.11
82 0.12
83 0.12
84 0.12
85 0.19
86 0.19
87 0.23
88 0.31
89 0.38
90 0.45
91 0.55
92 0.62
93 0.65
94 0.7
95 0.76
96 0.78
97 0.83
98 0.83
99 0.84
100 0.83
101 0.84
102 0.87
103 0.83
104 0.83
105 0.79
106 0.73
107 0.68
108 0.6
109 0.51
110 0.45