Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KHR8

Protein Details
Accession K0KHR8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
102-125QVKKQEKESRMEKLKKKRNSRVNKBasic
NLS Segment(s)
PositionSequence
104-125KKQEKESRMEKLKKKRNSRVNK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018851  Borealin_N  
Pfam View protein in Pfam  
PF10444  Nbl1_Borealin_N  
Amino Acid Sequences MVTYTQEEKNKLTTRFEKQAAERKQSLEEELQKLTKTFINKIERRSQRIPKKFMDLKIKDVLDVERDHKLKLYSLLKDISLMKRQYQGGMIDKETQLEISKQVKKQEKESRMEKLKKKRNSRVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.6
4 0.58
5 0.58
6 0.65
7 0.64
8 0.64
9 0.58
10 0.52
11 0.53
12 0.48
13 0.44
14 0.41
15 0.39
16 0.35
17 0.35
18 0.34
19 0.3
20 0.29
21 0.27
22 0.23
23 0.2
24 0.21
25 0.27
26 0.35
27 0.38
28 0.44
29 0.52
30 0.55
31 0.6
32 0.64
33 0.66
34 0.66
35 0.71
36 0.72
37 0.64
38 0.67
39 0.65
40 0.63
41 0.64
42 0.56
43 0.52
44 0.51
45 0.48
46 0.39
47 0.35
48 0.29
49 0.2
50 0.2
51 0.17
52 0.17
53 0.17
54 0.17
55 0.18
56 0.18
57 0.17
58 0.22
59 0.24
60 0.2
61 0.23
62 0.24
63 0.22
64 0.23
65 0.26
66 0.23
67 0.25
68 0.25
69 0.24
70 0.28
71 0.29
72 0.27
73 0.27
74 0.27
75 0.26
76 0.28
77 0.28
78 0.26
79 0.26
80 0.25
81 0.23
82 0.2
83 0.15
84 0.14
85 0.17
86 0.22
87 0.29
88 0.31
89 0.4
90 0.49
91 0.51
92 0.6
93 0.65
94 0.66
95 0.67
96 0.7
97 0.72
98 0.73
99 0.8
100 0.79
101 0.79
102 0.81
103 0.83
104 0.88
105 0.88