Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KSZ8

Protein Details
Accession K0KSZ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-119VKNINDCRTNKKKFNYHPEFAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, cyto 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKFSTILTQGLLLSGIIASPIASNTPDATPDLAEGSYADNSTDVLAGNKYYYKLCFDTEASGFCFGNDLNTCIRHYYAGGPKFSYDNAVAYCSFWCSKVKNINDCRTNKKKFNYHPEFACKDQKYCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.09
12 0.09
13 0.1
14 0.11
15 0.11
16 0.11
17 0.11
18 0.11
19 0.09
20 0.09
21 0.08
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.09
38 0.1
39 0.12
40 0.13
41 0.14
42 0.16
43 0.15
44 0.17
45 0.17
46 0.17
47 0.15
48 0.15
49 0.14
50 0.12
51 0.11
52 0.08
53 0.1
54 0.09
55 0.1
56 0.1
57 0.11
58 0.12
59 0.12
60 0.13
61 0.1
62 0.1
63 0.15
64 0.21
65 0.24
66 0.25
67 0.25
68 0.25
69 0.26
70 0.25
71 0.22
72 0.15
73 0.13
74 0.13
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.13
81 0.13
82 0.15
83 0.15
84 0.23
85 0.31
86 0.38
87 0.46
88 0.54
89 0.62
90 0.68
91 0.71
92 0.74
93 0.75
94 0.76
95 0.75
96 0.75
97 0.76
98 0.77
99 0.83
100 0.82
101 0.79
102 0.78
103 0.79
104 0.76
105 0.71
106 0.71
107 0.63