Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KNS1

Protein Details
Accession K0KNS1    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
288-308LKFLVKRAFRSNKQVEEKKNKHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, plas 8, nucl 2, mito 2, cyto 2, cyto_nucl 2, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037654  Big1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Amino Acid Sequences MYWKSFIAQIFVVSLCFQSACCSVPLIVYSHLLVPKLQAYINNFKHLEFPIERLNEVTKKAIEPCTSDAYVLVNHPGLTLEDLQDPSLFKFLRTYMLMSSSLGAIPRAEKPVDFDKLEDLAISRCGAHKIEVDGLEEVPTYIDSRTRVIRVNFPRLPEDPEERKEALIKADEALRHTLRKLPSPHHTMIYTNQEPGVLNKLKERKYSKLDIFEDITREPTRQYEVERNIKEKKVEPYFHEKRTNLIDRKASEPPKFFDADFLIENEVLVLGIVGITLVLFIHQTFLLLKFLVKRAFRSNKQVEEKKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.1
4 0.09
5 0.11
6 0.12
7 0.13
8 0.13
9 0.14
10 0.14
11 0.15
12 0.16
13 0.15
14 0.15
15 0.15
16 0.15
17 0.18
18 0.19
19 0.19
20 0.17
21 0.17
22 0.17
23 0.18
24 0.18
25 0.18
26 0.23
27 0.33
28 0.36
29 0.41
30 0.4
31 0.38
32 0.41
33 0.38
34 0.39
35 0.3
36 0.3
37 0.3
38 0.31
39 0.31
40 0.29
41 0.33
42 0.29
43 0.3
44 0.3
45 0.24
46 0.24
47 0.28
48 0.32
49 0.29
50 0.3
51 0.32
52 0.34
53 0.33
54 0.3
55 0.26
56 0.22
57 0.21
58 0.18
59 0.16
60 0.11
61 0.1
62 0.1
63 0.1
64 0.09
65 0.1
66 0.11
67 0.1
68 0.12
69 0.12
70 0.13
71 0.13
72 0.13
73 0.12
74 0.16
75 0.14
76 0.12
77 0.14
78 0.14
79 0.18
80 0.18
81 0.19
82 0.15
83 0.18
84 0.19
85 0.16
86 0.16
87 0.12
88 0.11
89 0.1
90 0.09
91 0.07
92 0.08
93 0.1
94 0.12
95 0.12
96 0.11
97 0.16
98 0.21
99 0.24
100 0.23
101 0.21
102 0.21
103 0.21
104 0.21
105 0.17
106 0.12
107 0.09
108 0.09
109 0.09
110 0.07
111 0.07
112 0.09
113 0.1
114 0.1
115 0.11
116 0.12
117 0.14
118 0.15
119 0.15
120 0.14
121 0.13
122 0.12
123 0.11
124 0.09
125 0.06
126 0.06
127 0.05
128 0.05
129 0.06
130 0.07
131 0.09
132 0.11
133 0.13
134 0.17
135 0.18
136 0.26
137 0.3
138 0.38
139 0.38
140 0.38
141 0.39
142 0.36
143 0.39
144 0.33
145 0.34
146 0.3
147 0.31
148 0.33
149 0.3
150 0.3
151 0.28
152 0.25
153 0.2
154 0.17
155 0.15
156 0.12
157 0.14
158 0.14
159 0.14
160 0.17
161 0.16
162 0.16
163 0.16
164 0.2
165 0.19
166 0.26
167 0.28
168 0.29
169 0.35
170 0.41
171 0.42
172 0.4
173 0.39
174 0.34
175 0.35
176 0.38
177 0.32
178 0.25
179 0.24
180 0.22
181 0.21
182 0.21
183 0.24
184 0.18
185 0.17
186 0.23
187 0.3
188 0.33
189 0.4
190 0.45
191 0.44
192 0.48
193 0.56
194 0.55
195 0.57
196 0.56
197 0.51
198 0.49
199 0.43
200 0.39
201 0.31
202 0.3
203 0.22
204 0.21
205 0.18
206 0.17
207 0.19
208 0.18
209 0.23
210 0.28
211 0.35
212 0.44
213 0.47
214 0.51
215 0.53
216 0.54
217 0.53
218 0.49
219 0.5
220 0.5
221 0.5
222 0.51
223 0.55
224 0.6
225 0.64
226 0.67
227 0.58
228 0.53
229 0.58
230 0.62
231 0.57
232 0.56
233 0.54
234 0.49
235 0.54
236 0.58
237 0.56
238 0.53
239 0.52
240 0.49
241 0.46
242 0.46
243 0.41
244 0.36
245 0.32
246 0.28
247 0.25
248 0.23
249 0.21
250 0.18
251 0.18
252 0.14
253 0.11
254 0.08
255 0.06
256 0.05
257 0.03
258 0.03
259 0.03
260 0.02
261 0.02
262 0.02
263 0.02
264 0.02
265 0.03
266 0.03
267 0.04
268 0.06
269 0.06
270 0.07
271 0.08
272 0.1
273 0.12
274 0.12
275 0.14
276 0.17
277 0.22
278 0.29
279 0.3
280 0.33
281 0.42
282 0.52
283 0.57
284 0.63
285 0.66
286 0.69
287 0.78
288 0.82