Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KKF2

Protein Details
Accession K0KKF2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-39SGPFSFKNPNHKHPTRRVKATKQLIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MTEVDIYEVAQSNSGPFSFKNPNHKHPTRRVKATKQLIIDEQKYLKLNEDKLKSNSINYFTIESPPSLKPSKKYCDITGLKGNYKSPSSGIRYYNGEIYSIVKNMASGVDQQYLELRNANVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.16
5 0.25
6 0.3
7 0.4
8 0.46
9 0.56
10 0.64
11 0.72
12 0.74
13 0.76
14 0.82
15 0.8
16 0.83
17 0.83
18 0.81
19 0.84
20 0.84
21 0.78
22 0.7
23 0.64
24 0.59
25 0.55
26 0.48
27 0.41
28 0.33
29 0.3
30 0.29
31 0.26
32 0.26
33 0.24
34 0.27
35 0.31
36 0.34
37 0.35
38 0.36
39 0.41
40 0.36
41 0.35
42 0.33
43 0.29
44 0.27
45 0.23
46 0.23
47 0.18
48 0.2
49 0.18
50 0.15
51 0.15
52 0.14
53 0.17
54 0.18
55 0.2
56 0.23
57 0.3
58 0.35
59 0.4
60 0.42
61 0.4
62 0.47
63 0.48
64 0.48
65 0.48
66 0.46
67 0.42
68 0.4
69 0.41
70 0.33
71 0.32
72 0.28
73 0.22
74 0.25
75 0.27
76 0.3
77 0.3
78 0.31
79 0.34
80 0.34
81 0.37
82 0.3
83 0.25
84 0.21
85 0.22
86 0.2
87 0.17
88 0.16
89 0.11
90 0.11
91 0.11
92 0.11
93 0.09
94 0.1
95 0.13
96 0.17
97 0.17
98 0.17
99 0.2
100 0.21
101 0.21
102 0.21
103 0.18
104 0.16