Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KAB8

Protein Details
Accession K0KAB8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAQRVTYRRRNPYNTRSNKIKVHydrophilic
NLS Segment(s)
PositionSequence
111-124KEQKAEKKASKSKK
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTYRRRNPYNTRSNKIKVVKTPGGVLRAQHVKKSGTRPKCGDCGTALPGISALRPREYAQVSKTHKTVSRAYGGSRCANCVKERVVRAFLIEEQKIVKRVLKEQSEKEQKAEKKASKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.82
4 0.77
5 0.77
6 0.75
7 0.71
8 0.67
9 0.67
10 0.64
11 0.57
12 0.57
13 0.51
14 0.47
15 0.41
16 0.34
17 0.31
18 0.35
19 0.34
20 0.32
21 0.31
22 0.31
23 0.35
24 0.45
25 0.49
26 0.47
27 0.53
28 0.55
29 0.56
30 0.6
31 0.56
32 0.47
33 0.39
34 0.35
35 0.3
36 0.27
37 0.23
38 0.16
39 0.15
40 0.14
41 0.12
42 0.12
43 0.1
44 0.1
45 0.11
46 0.12
47 0.16
48 0.18
49 0.2
50 0.19
51 0.26
52 0.3
53 0.31
54 0.31
55 0.3
56 0.31
57 0.33
58 0.35
59 0.3
60 0.31
61 0.29
62 0.31
63 0.32
64 0.32
65 0.34
66 0.3
67 0.29
68 0.27
69 0.28
70 0.27
71 0.27
72 0.28
73 0.29
74 0.32
75 0.33
76 0.33
77 0.31
78 0.31
79 0.3
80 0.29
81 0.29
82 0.25
83 0.22
84 0.22
85 0.24
86 0.25
87 0.25
88 0.24
89 0.22
90 0.28
91 0.36
92 0.43
93 0.48
94 0.52
95 0.61
96 0.68
97 0.66
98 0.65
99 0.65
100 0.61
101 0.63
102 0.67
103 0.63
104 0.63