Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S3C3

Protein Details
Accession E3S3C3   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-45IKKAYRKAALKWHPDKNKDNPQALHydrophilic
210-229NGTTKKLKIKRKTYDQSTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 10, mito 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002939  DnaJ_C  
IPR001623  DnaJ_domain  
IPR008971  HSP40/DnaJ_pept-bd  
IPR036869  J_dom_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005634  C:nucleus  
GO:0140453  C:protein aggregate center  
GO:0051787  F:misfolded protein binding  
GO:0051082  F:unfolded protein binding  
GO:0070843  P:misfolded protein transport  
GO:0072671  P:mitochondria-associated ubiquitin-dependent protein catabolic process  
GO:0071630  P:nuclear protein quality control by the ubiquitin-proteasome system  
GO:0006457  P:protein folding  
GO:0006413  P:translational initiation  
GO:0035719  P:tRNA import into nucleus  
KEGG pte:PTT_16957  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF01556  DnaJ_C  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
cd10747  DnaJ_C  
Amino Acid Sequences MVKETKLYDSLGISETATQDEIKKAYRKAALKWHPDKNKDNPQALEKFKECSQAYEILSDPEKRKTYDQYGLEFILRGGVPQEEGAGPGSNPFAGAGGAGGAGGFPFASSGGMPGGTRSFHFSTGGGGNGFNFSSAEDIFGEFMRNSGGGGGGGGDEFDFGGFGMGGMPGGMGGAAGGKGGRFRNGRRAPEPEVTVVEKPLAVSLEELYNGTTKKLKIKRKTYDQSTGKQSTQDRILEVPIKKGLKAGSKIKFSDVGDQVEGGTQDLHFIVSEKPHAMFIREGDDVKHIIEIDLKEALTGWRRTVQTIDGKQLSVGSGGPTGPNWTERYPNLGMPKSKKPTERGDFVVGVKIKFPTSLTSAQKEKLKEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.15
5 0.14
6 0.15
7 0.18
8 0.2
9 0.24
10 0.3
11 0.31
12 0.37
13 0.44
14 0.47
15 0.5
16 0.58
17 0.61
18 0.66
19 0.73
20 0.75
21 0.77
22 0.81
23 0.82
24 0.81
25 0.82
26 0.8
27 0.78
28 0.72
29 0.7
30 0.7
31 0.67
32 0.64
33 0.54
34 0.49
35 0.45
36 0.5
37 0.42
38 0.38
39 0.37
40 0.36
41 0.35
42 0.34
43 0.32
44 0.27
45 0.29
46 0.31
47 0.3
48 0.31
49 0.33
50 0.33
51 0.37
52 0.41
53 0.46
54 0.49
55 0.5
56 0.46
57 0.47
58 0.45
59 0.42
60 0.34
61 0.26
62 0.21
63 0.17
64 0.13
65 0.11
66 0.09
67 0.09
68 0.09
69 0.11
70 0.07
71 0.08
72 0.1
73 0.09
74 0.09
75 0.09
76 0.1
77 0.08
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.05
101 0.06
102 0.07
103 0.07
104 0.08
105 0.13
106 0.14
107 0.15
108 0.16
109 0.15
110 0.17
111 0.17
112 0.18
113 0.13
114 0.11
115 0.1
116 0.1
117 0.1
118 0.07
119 0.06
120 0.05
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.09
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.02
147 0.02
148 0.03
149 0.02
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.02
156 0.02
157 0.02
158 0.02
159 0.01
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.05
167 0.06
168 0.11
169 0.14
170 0.15
171 0.26
172 0.33
173 0.38
174 0.39
175 0.44
176 0.44
177 0.45
178 0.45
179 0.35
180 0.31
181 0.28
182 0.25
183 0.2
184 0.15
185 0.12
186 0.1
187 0.09
188 0.08
189 0.05
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.06
196 0.08
197 0.08
198 0.08
199 0.11
200 0.12
201 0.21
202 0.29
203 0.38
204 0.46
205 0.56
206 0.64
207 0.72
208 0.8
209 0.78
210 0.8
211 0.76
212 0.72
213 0.71
214 0.66
215 0.56
216 0.52
217 0.47
218 0.4
219 0.4
220 0.35
221 0.27
222 0.24
223 0.26
224 0.28
225 0.27
226 0.26
227 0.26
228 0.26
229 0.24
230 0.26
231 0.26
232 0.27
233 0.32
234 0.38
235 0.39
236 0.43
237 0.44
238 0.44
239 0.45
240 0.39
241 0.41
242 0.36
243 0.32
244 0.27
245 0.26
246 0.24
247 0.2
248 0.19
249 0.11
250 0.09
251 0.06
252 0.06
253 0.06
254 0.06
255 0.05
256 0.07
257 0.08
258 0.09
259 0.11
260 0.12
261 0.12
262 0.16
263 0.16
264 0.17
265 0.17
266 0.17
267 0.19
268 0.19
269 0.19
270 0.17
271 0.19
272 0.17
273 0.16
274 0.16
275 0.12
276 0.1
277 0.14
278 0.14
279 0.14
280 0.15
281 0.14
282 0.13
283 0.13
284 0.15
285 0.18
286 0.19
287 0.19
288 0.24
289 0.25
290 0.26
291 0.28
292 0.31
293 0.35
294 0.37
295 0.43
296 0.38
297 0.38
298 0.36
299 0.35
300 0.29
301 0.2
302 0.17
303 0.11
304 0.1
305 0.1
306 0.1
307 0.1
308 0.13
309 0.13
310 0.16
311 0.19
312 0.2
313 0.25
314 0.25
315 0.32
316 0.32
317 0.35
318 0.4
319 0.43
320 0.48
321 0.49
322 0.58
323 0.59
324 0.64
325 0.65
326 0.64
327 0.68
328 0.69
329 0.69
330 0.64
331 0.62
332 0.58
333 0.53
334 0.55
335 0.46
336 0.39
337 0.35
338 0.31
339 0.25
340 0.23
341 0.23
342 0.19
343 0.23
344 0.31
345 0.35
346 0.4
347 0.44
348 0.48
349 0.53
350 0.51