Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KFA1

Protein Details
Accession K0KFA1    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
131-150LEKLRQLRLKKDRLKFKLSSHydrophilic
NLS Segment(s)
PositionSequence
140-149KKDRLKFKLS
152-152K
155-157HRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013251  DASH_Spc19  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005876  C:spindle microtubule  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
Pfam View protein in Pfam  
PF08287  DASH_Spc19  
Amino Acid Sequences MSYSYANTLNGSISSLSASVSLLGNSLNSLDALSEDFERLPTVLKQSNIFTLIPETDLNDAKQHLVYELEPKIEALKDKVRLKISKLERKKSNLVSKIELNQVRINNFKNDEKAKKANQENVEIEGSEEELEKLRQLRLKKDRLKFKLSSVKLQHRKARLSMIPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.06
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.07
21 0.07
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.1
28 0.1
29 0.15
30 0.18
31 0.19
32 0.21
33 0.22
34 0.24
35 0.24
36 0.23
37 0.18
38 0.16
39 0.15
40 0.15
41 0.13
42 0.12
43 0.12
44 0.13
45 0.13
46 0.12
47 0.12
48 0.11
49 0.12
50 0.11
51 0.09
52 0.09
53 0.09
54 0.13
55 0.13
56 0.13
57 0.12
58 0.12
59 0.13
60 0.12
61 0.13
62 0.11
63 0.15
64 0.21
65 0.24
66 0.29
67 0.32
68 0.33
69 0.35
70 0.4
71 0.45
72 0.48
73 0.53
74 0.57
75 0.58
76 0.62
77 0.66
78 0.65
79 0.65
80 0.62
81 0.58
82 0.53
83 0.5
84 0.47
85 0.48
86 0.41
87 0.35
88 0.32
89 0.3
90 0.3
91 0.3
92 0.29
93 0.26
94 0.29
95 0.28
96 0.3
97 0.36
98 0.38
99 0.41
100 0.46
101 0.47
102 0.52
103 0.56
104 0.58
105 0.54
106 0.56
107 0.51
108 0.48
109 0.43
110 0.34
111 0.29
112 0.21
113 0.18
114 0.11
115 0.1
116 0.07
117 0.08
118 0.08
119 0.1
120 0.12
121 0.15
122 0.19
123 0.23
124 0.33
125 0.41
126 0.52
127 0.59
128 0.66
129 0.74
130 0.76
131 0.8
132 0.73
133 0.73
134 0.73
135 0.67
136 0.68
137 0.67
138 0.71
139 0.73
140 0.79
141 0.77
142 0.74
143 0.76
144 0.7
145 0.7