Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KWW6

Protein Details
Accession K0KWW6    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSAPRKTTKASRKKKGESLSAYHydrophilic
NLS Segment(s)
PositionSequence
8-15TKASRKKK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSAPRKTTKASRKKKGESLSAYMFFANDNRDIVRSENPGISFGGVGKLLGERWKALDDEGKKPYNAKAEADKKRYEEEKANYQAQQQDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.82
4 0.77
5 0.73
6 0.69
7 0.6
8 0.52
9 0.43
10 0.36
11 0.26
12 0.21
13 0.17
14 0.11
15 0.11
16 0.11
17 0.12
18 0.13
19 0.14
20 0.16
21 0.17
22 0.17
23 0.18
24 0.18
25 0.18
26 0.17
27 0.15
28 0.12
29 0.09
30 0.08
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.07
37 0.08
38 0.07
39 0.08
40 0.1
41 0.1
42 0.11
43 0.17
44 0.18
45 0.24
46 0.29
47 0.3
48 0.29
49 0.3
50 0.33
51 0.34
52 0.33
53 0.3
54 0.34
55 0.43
56 0.52
57 0.56
58 0.56
59 0.51
60 0.56
61 0.56
62 0.51
63 0.5
64 0.48
65 0.52
66 0.55
67 0.56
68 0.51
69 0.52
70 0.52