Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KPS9

Protein Details
Accession K0KPS9   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
324-346FENFIMKFAKKKKIGKKIIITSRHydrophilic
NLS Segment(s)
PositionSequence
332-341AKKKKIGKKI
Subcellular Location(s) nucl 19, cyto 3, golg 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MELDVLVNLQSDNTYRLVELSPELQSLLEENNESLYIKASTEENDIVLCSETQTFQLKQRNHSNTVLLMKYLGLGDNTLQSYSLQSNVFEIKPIKGTISPINIPIYDGQGNFIKNGNNITVQYLKDNSPISTNEFDKVWFELNGSQLNDRAIILSRDFINKSLHLLIMSIMAANLDINELSLIEVYKTLSEDDDYSIDIVETILRKYSNEDSEPFSLNKIKIAQWYGIESLKKFASNDKLISPSEFLIKWKSEFPPFFDISIDLPLLKGYYVKPLPDRIKYMPWDKLSKDINERLNTLFKNQSTWELDDLIPYIQEFNTKNLKFENFIMKFAKKKKIGKKIIITSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.15
5 0.15
6 0.16
7 0.17
8 0.17
9 0.16
10 0.17
11 0.15
12 0.14
13 0.14
14 0.13
15 0.12
16 0.11
17 0.11
18 0.12
19 0.12
20 0.13
21 0.11
22 0.12
23 0.11
24 0.1
25 0.12
26 0.12
27 0.13
28 0.17
29 0.17
30 0.15
31 0.15
32 0.15
33 0.14
34 0.14
35 0.12
36 0.09
37 0.09
38 0.1
39 0.12
40 0.17
41 0.18
42 0.24
43 0.33
44 0.36
45 0.42
46 0.52
47 0.56
48 0.57
49 0.57
50 0.53
51 0.49
52 0.51
53 0.43
54 0.33
55 0.27
56 0.21
57 0.19
58 0.17
59 0.13
60 0.08
61 0.07
62 0.08
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.12
69 0.12
70 0.15
71 0.12
72 0.12
73 0.14
74 0.17
75 0.17
76 0.18
77 0.18
78 0.17
79 0.18
80 0.19
81 0.18
82 0.16
83 0.2
84 0.21
85 0.25
86 0.24
87 0.24
88 0.25
89 0.24
90 0.23
91 0.21
92 0.2
93 0.16
94 0.15
95 0.15
96 0.16
97 0.16
98 0.16
99 0.18
100 0.15
101 0.14
102 0.16
103 0.15
104 0.14
105 0.14
106 0.16
107 0.17
108 0.16
109 0.17
110 0.18
111 0.17
112 0.19
113 0.2
114 0.18
115 0.17
116 0.18
117 0.2
118 0.21
119 0.22
120 0.19
121 0.18
122 0.18
123 0.16
124 0.16
125 0.14
126 0.1
127 0.1
128 0.11
129 0.13
130 0.16
131 0.15
132 0.15
133 0.14
134 0.14
135 0.14
136 0.11
137 0.1
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.12
144 0.12
145 0.13
146 0.14
147 0.13
148 0.15
149 0.15
150 0.14
151 0.11
152 0.11
153 0.09
154 0.08
155 0.08
156 0.05
157 0.04
158 0.04
159 0.04
160 0.03
161 0.03
162 0.02
163 0.02
164 0.02
165 0.02
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.07
180 0.08
181 0.08
182 0.07
183 0.07
184 0.06
185 0.06
186 0.05
187 0.05
188 0.06
189 0.06
190 0.07
191 0.07
192 0.08
193 0.11
194 0.16
195 0.18
196 0.2
197 0.21
198 0.24
199 0.26
200 0.29
201 0.25
202 0.23
203 0.23
204 0.21
205 0.22
206 0.2
207 0.19
208 0.2
209 0.22
210 0.22
211 0.19
212 0.21
213 0.21
214 0.22
215 0.22
216 0.18
217 0.19
218 0.18
219 0.18
220 0.16
221 0.2
222 0.24
223 0.26
224 0.28
225 0.27
226 0.3
227 0.3
228 0.3
229 0.27
230 0.2
231 0.19
232 0.18
233 0.17
234 0.18
235 0.19
236 0.19
237 0.22
238 0.25
239 0.3
240 0.3
241 0.34
242 0.36
243 0.36
244 0.35
245 0.32
246 0.29
247 0.23
248 0.23
249 0.19
250 0.12
251 0.1
252 0.1
253 0.09
254 0.08
255 0.08
256 0.07
257 0.16
258 0.17
259 0.2
260 0.23
261 0.32
262 0.38
263 0.41
264 0.46
265 0.42
266 0.47
267 0.5
268 0.54
269 0.53
270 0.52
271 0.53
272 0.48
273 0.53
274 0.5
275 0.51
276 0.52
277 0.51
278 0.54
279 0.51
280 0.52
281 0.47
282 0.49
283 0.44
284 0.41
285 0.41
286 0.33
287 0.34
288 0.33
289 0.37
290 0.35
291 0.37
292 0.34
293 0.3
294 0.3
295 0.27
296 0.27
297 0.2
298 0.15
299 0.13
300 0.12
301 0.09
302 0.15
303 0.15
304 0.2
305 0.3
306 0.3
307 0.32
308 0.35
309 0.38
310 0.36
311 0.39
312 0.45
313 0.36
314 0.41
315 0.45
316 0.45
317 0.5
318 0.55
319 0.6
320 0.58
321 0.66
322 0.72
323 0.77
324 0.83
325 0.85
326 0.87