Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KPR3

Protein Details
Accession K0KPR3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-179LHVLVKRCFKKRNKINVSDRLNGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 7, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MIIAKNKLVFHLIDPQGETIIHPYSKAVVQLILSRHLRSIRRDIVKLRIHTNDPSYGPVIDSVTQEGLDNLDFESSRKRDKGYFKTNDVIFPYKDPDPNIDQRNFLFDNIEVSNRLTNKEKTRKLAYLVIKQSRGSRSDLLNIDQNSRANVKISTLHVLVKRCFKKRNKINVSDRLNGNSIIDYKKSPLFLKRDDNHLSEVIKDIAKQSMDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.25
5 0.23
6 0.16
7 0.17
8 0.15
9 0.14
10 0.14
11 0.16
12 0.17
13 0.18
14 0.15
15 0.12
16 0.14
17 0.18
18 0.19
19 0.24
20 0.25
21 0.24
22 0.26
23 0.31
24 0.34
25 0.35
26 0.42
27 0.44
28 0.49
29 0.52
30 0.53
31 0.57
32 0.6
33 0.58
34 0.54
35 0.5
36 0.47
37 0.46
38 0.45
39 0.4
40 0.34
41 0.33
42 0.29
43 0.24
44 0.21
45 0.19
46 0.17
47 0.14
48 0.13
49 0.12
50 0.11
51 0.11
52 0.1
53 0.09
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.13
62 0.15
63 0.19
64 0.2
65 0.22
66 0.27
67 0.37
68 0.46
69 0.49
70 0.53
71 0.52
72 0.57
73 0.56
74 0.52
75 0.47
76 0.4
77 0.3
78 0.25
79 0.25
80 0.21
81 0.22
82 0.2
83 0.2
84 0.22
85 0.28
86 0.31
87 0.29
88 0.28
89 0.27
90 0.31
91 0.28
92 0.23
93 0.17
94 0.12
95 0.14
96 0.13
97 0.14
98 0.1
99 0.1
100 0.13
101 0.12
102 0.14
103 0.15
104 0.2
105 0.28
106 0.37
107 0.41
108 0.44
109 0.49
110 0.49
111 0.48
112 0.51
113 0.48
114 0.47
115 0.5
116 0.49
117 0.45
118 0.44
119 0.45
120 0.41
121 0.37
122 0.32
123 0.28
124 0.25
125 0.3
126 0.31
127 0.28
128 0.3
129 0.29
130 0.28
131 0.27
132 0.26
133 0.21
134 0.21
135 0.2
136 0.16
137 0.15
138 0.14
139 0.16
140 0.17
141 0.19
142 0.19
143 0.22
144 0.24
145 0.28
146 0.3
147 0.36
148 0.41
149 0.44
150 0.53
151 0.57
152 0.65
153 0.71
154 0.79
155 0.8
156 0.83
157 0.86
158 0.87
159 0.85
160 0.81
161 0.73
162 0.65
163 0.57
164 0.47
165 0.38
166 0.3
167 0.26
168 0.21
169 0.21
170 0.19
171 0.2
172 0.23
173 0.25
174 0.27
175 0.31
176 0.36
177 0.41
178 0.5
179 0.51
180 0.56
181 0.58
182 0.57
183 0.53
184 0.5
185 0.43
186 0.34
187 0.33
188 0.28
189 0.23
190 0.21
191 0.2
192 0.21
193 0.21