Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KL24

Protein Details
Accession K0KL24    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRKKKSAREKRLDNFRSNRSNHydrophilic
NLS Segment(s)
PositionSequence
3-11RKKKSAREK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGRKKKSAREKRLDNFRSNRSNYLDSTENKKKEMGHKDDDNDDDDKVKRRKVPEPTDKQNDQGSHGTSQKLDEKFSMFNFVSDNKEKLKQNVESEMIKSSIDIDIRNFYRGFEPETIENIKKKILWLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.8
4 0.79
5 0.72
6 0.68
7 0.63
8 0.6
9 0.51
10 0.48
11 0.45
12 0.39
13 0.44
14 0.48
15 0.44
16 0.41
17 0.42
18 0.42
19 0.45
20 0.52
21 0.5
22 0.48
23 0.52
24 0.54
25 0.55
26 0.52
27 0.46
28 0.37
29 0.3
30 0.25
31 0.22
32 0.27
33 0.27
34 0.29
35 0.31
36 0.35
37 0.42
38 0.49
39 0.57
40 0.6
41 0.65
42 0.7
43 0.73
44 0.69
45 0.65
46 0.59
47 0.49
48 0.42
49 0.35
50 0.28
51 0.23
52 0.24
53 0.22
54 0.17
55 0.19
56 0.21
57 0.2
58 0.19
59 0.17
60 0.17
61 0.18
62 0.19
63 0.22
64 0.16
65 0.16
66 0.16
67 0.17
68 0.2
69 0.21
70 0.23
71 0.2
72 0.26
73 0.28
74 0.3
75 0.35
76 0.35
77 0.36
78 0.39
79 0.4
80 0.36
81 0.36
82 0.34
83 0.27
84 0.22
85 0.18
86 0.15
87 0.14
88 0.13
89 0.12
90 0.12
91 0.19
92 0.2
93 0.23
94 0.22
95 0.21
96 0.24
97 0.25
98 0.28
99 0.23
100 0.26
101 0.25
102 0.3
103 0.34
104 0.34
105 0.35
106 0.32
107 0.32
108 0.3