Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KIX4

Protein Details
Accession K0KIX4   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-81TESKENQPTGKKRRKTDDKYKEKKRVKMEQDINTKKKBasic
NLS Segment(s)
PositionSequence
52-71PTGKKRRKTDDKYKEKKRVK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSNNPDDLDDGLDYQVDSEPEAEGVEIKEDESEDEIVKPSKKEETESKENQPTGKKRRKTDDKYKEKKRVKMEQDINTKKKIPQLNSTDLAHHFSQLLIKFNKDSTHLDYFKKSDFVDGSNYKETRNLDNFKDFTDKYNKGLTIILSISRVRIGDLYKALGPKSKAMKVGKGYESKVRDDTKYVLGTVEKMLNFDFGSHEVKSLILDTTYQDQKSHSILDEPKLTTLLKKYEGKKIILY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.11
19 0.12
20 0.11
21 0.12
22 0.14
23 0.17
24 0.2
25 0.19
26 0.2
27 0.25
28 0.25
29 0.3
30 0.37
31 0.42
32 0.49
33 0.54
34 0.6
35 0.6
36 0.61
37 0.6
38 0.59
39 0.6
40 0.62
41 0.66
42 0.65
43 0.66
44 0.76
45 0.82
46 0.83
47 0.85
48 0.85
49 0.86
50 0.89
51 0.92
52 0.92
53 0.89
54 0.87
55 0.85
56 0.84
57 0.8
58 0.8
59 0.78
60 0.76
61 0.79
62 0.81
63 0.75
64 0.68
65 0.63
66 0.55
67 0.53
68 0.5
69 0.43
70 0.43
71 0.47
72 0.49
73 0.5
74 0.48
75 0.44
76 0.39
77 0.38
78 0.29
79 0.22
80 0.16
81 0.13
82 0.16
83 0.14
84 0.19
85 0.16
86 0.17
87 0.17
88 0.18
89 0.19
90 0.18
91 0.2
92 0.2
93 0.27
94 0.29
95 0.3
96 0.31
97 0.31
98 0.29
99 0.28
100 0.23
101 0.17
102 0.15
103 0.15
104 0.19
105 0.19
106 0.22
107 0.24
108 0.25
109 0.22
110 0.25
111 0.25
112 0.24
113 0.29
114 0.29
115 0.27
116 0.31
117 0.32
118 0.3
119 0.33
120 0.28
121 0.26
122 0.31
123 0.3
124 0.27
125 0.31
126 0.29
127 0.26
128 0.26
129 0.23
130 0.17
131 0.16
132 0.14
133 0.12
134 0.12
135 0.11
136 0.11
137 0.11
138 0.09
139 0.1
140 0.1
141 0.12
142 0.13
143 0.14
144 0.15
145 0.16
146 0.16
147 0.18
148 0.18
149 0.21
150 0.26
151 0.27
152 0.33
153 0.34
154 0.39
155 0.41
156 0.46
157 0.47
158 0.46
159 0.45
160 0.45
161 0.46
162 0.43
163 0.44
164 0.4
165 0.36
166 0.35
167 0.35
168 0.33
169 0.31
170 0.28
171 0.24
172 0.21
173 0.21
174 0.2
175 0.21
176 0.16
177 0.15
178 0.16
179 0.16
180 0.15
181 0.14
182 0.14
183 0.12
184 0.16
185 0.15
186 0.15
187 0.14
188 0.14
189 0.14
190 0.13
191 0.11
192 0.08
193 0.09
194 0.1
195 0.17
196 0.22
197 0.22
198 0.22
199 0.22
200 0.25
201 0.27
202 0.27
203 0.21
204 0.24
205 0.27
206 0.31
207 0.36
208 0.34
209 0.33
210 0.33
211 0.32
212 0.29
213 0.31
214 0.32
215 0.33
216 0.4
217 0.44
218 0.52
219 0.57