Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KGZ2

Protein Details
Accession K0KGZ2   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-126YLKFKILTFPPRRKRRGKGAPKKKREPPSAHGKKKBasic
NLS Segment(s)
PositionSequence
102-126PRRKRRGKGAPKKKREPPSAHGKKK
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSLIPNKARLLELVKLRCKVFNENYNPTNIRTGSKILSSKLKGPTVKDYYGNPEILSLRQVQGLHPEMKFADPAEVYRLKIHASYVLLYFDYLKFKILTFPPRRKRRGKGAPKKKREPPSAHGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.46
4 0.47
5 0.46
6 0.48
7 0.48
8 0.49
9 0.51
10 0.55
11 0.56
12 0.58
13 0.56
14 0.49
15 0.46
16 0.37
17 0.31
18 0.25
19 0.27
20 0.22
21 0.26
22 0.26
23 0.24
24 0.3
25 0.3
26 0.34
27 0.37
28 0.4
29 0.37
30 0.38
31 0.44
32 0.42
33 0.42
34 0.38
35 0.34
36 0.36
37 0.36
38 0.33
39 0.24
40 0.21
41 0.19
42 0.18
43 0.18
44 0.12
45 0.1
46 0.11
47 0.12
48 0.1
49 0.14
50 0.17
51 0.18
52 0.16
53 0.16
54 0.15
55 0.15
56 0.15
57 0.11
58 0.1
59 0.08
60 0.08
61 0.12
62 0.13
63 0.14
64 0.14
65 0.15
66 0.13
67 0.14
68 0.14
69 0.12
70 0.12
71 0.12
72 0.12
73 0.13
74 0.12
75 0.12
76 0.13
77 0.11
78 0.13
79 0.12
80 0.13
81 0.12
82 0.12
83 0.18
84 0.22
85 0.31
86 0.38
87 0.48
88 0.58
89 0.67
90 0.76
91 0.8
92 0.83
93 0.84
94 0.85
95 0.86
96 0.87
97 0.88
98 0.91
99 0.92
100 0.94
101 0.93
102 0.92
103 0.9
104 0.88
105 0.84
106 0.84