Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KQP0

Protein Details
Accession K0KQP0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
160-194ESLGLTHSLKKQKNKKKRKDNDDKKPDSKIKRVKTBasic
NLS Segment(s)
PositionSequence
169-194KKQKNKKKRKDNDDKKPDSKIKRVKT
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MSTSTNFAHEYNRIGKWSSCTLTNEPLDIPIVSDYKGNLYNKESILEYLLNPDDFTSNQKLLISHIKSLKDIVELKISKNQSNELICSITGNILGSNGIPYIYLVKCQDIFAKKCLTTIHKDCLKCPVCDLEYSKDDIIVINPEIKEDIINQQERIEKLESLGLTHSLKKQKNKKKRKDNDDKKPDSKIKRVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.33
4 0.37
5 0.34
6 0.33
7 0.36
8 0.38
9 0.42
10 0.41
11 0.38
12 0.31
13 0.3
14 0.27
15 0.21
16 0.18
17 0.13
18 0.13
19 0.12
20 0.12
21 0.12
22 0.14
23 0.2
24 0.2
25 0.2
26 0.23
27 0.27
28 0.26
29 0.28
30 0.25
31 0.2
32 0.21
33 0.19
34 0.16
35 0.15
36 0.16
37 0.14
38 0.14
39 0.13
40 0.12
41 0.12
42 0.16
43 0.16
44 0.15
45 0.16
46 0.17
47 0.17
48 0.19
49 0.27
50 0.24
51 0.25
52 0.29
53 0.29
54 0.29
55 0.29
56 0.27
57 0.22
58 0.22
59 0.19
60 0.23
61 0.23
62 0.24
63 0.29
64 0.3
65 0.28
66 0.27
67 0.28
68 0.24
69 0.25
70 0.24
71 0.19
72 0.18
73 0.15
74 0.15
75 0.13
76 0.09
77 0.07
78 0.07
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.07
89 0.07
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.16
96 0.19
97 0.21
98 0.22
99 0.26
100 0.24
101 0.26
102 0.28
103 0.27
104 0.29
105 0.32
106 0.37
107 0.39
108 0.4
109 0.39
110 0.46
111 0.45
112 0.38
113 0.35
114 0.32
115 0.27
116 0.3
117 0.33
118 0.28
119 0.27
120 0.3
121 0.28
122 0.23
123 0.21
124 0.18
125 0.16
126 0.13
127 0.12
128 0.12
129 0.12
130 0.12
131 0.13
132 0.13
133 0.12
134 0.11
135 0.17
136 0.2
137 0.22
138 0.22
139 0.25
140 0.29
141 0.29
142 0.31
143 0.27
144 0.21
145 0.2
146 0.23
147 0.2
148 0.17
149 0.18
150 0.17
151 0.17
152 0.2
153 0.26
154 0.31
155 0.37
156 0.46
157 0.56
158 0.64
159 0.73
160 0.81
161 0.86
162 0.89
163 0.93
164 0.95
165 0.96
166 0.96
167 0.96
168 0.96
169 0.95
170 0.89
171 0.88
172 0.86
173 0.83
174 0.83