Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KV32

Protein Details
Accession K0KV32    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKKTQTKGKVVKKTPTKANTKPKGSIHydrophilic
112-132FSTKKNFKPKLIKVDNKPKSEHydrophilic
351-392PQIFASKIKKSSKQLKKENKNKISKPIVNTKKSTKTKKSVKAHydrophilic
NLS Segment(s)
PositionSequence
357-392KIKKSSKQLKKENKNKISKPIVNTKKSTKTKKSVKA
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MAKKTQTKGKVVKKTPTKANTKPKGSIVKASNVEDVVPTLAEEAKAAAKNSKNVSKTDDLVDESKIEKALNELNKFVSKSNEESESKDGKTQLFDDELSDNLQLIFTKKDLFSTKKNFKPKLIKVDNKPKSEEEPKVILFIRDGIVDSKILDQIESSELNNILTKIIAGSELKTTYKQYEKRRELFSNNDIFLADDSLITSLPKLLGKTFYESNKIPIPIKISKDNFSIKATFNHIQKVLNSIVYHIPRSNNLSINLGSIESINKSLISQVIQHFKDEELRSIFIKTNQSPALPLYEVSEVYTEEDLEQNQKSNDKVIKSNNEAIEGLPENIKLSEFEKGLLELANPKEVPQIFASKIKKSSKQLKKENKNKISKPIVNTKKSTKTKKSVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.83
5 0.82
6 0.86
7 0.86
8 0.83
9 0.79
10 0.77
11 0.78
12 0.72
13 0.7
14 0.64
15 0.63
16 0.6
17 0.58
18 0.52
19 0.42
20 0.39
21 0.3
22 0.27
23 0.19
24 0.14
25 0.11
26 0.09
27 0.1
28 0.09
29 0.09
30 0.09
31 0.13
32 0.15
33 0.16
34 0.22
35 0.24
36 0.3
37 0.37
38 0.43
39 0.41
40 0.41
41 0.47
42 0.45
43 0.44
44 0.42
45 0.38
46 0.33
47 0.33
48 0.31
49 0.26
50 0.23
51 0.22
52 0.19
53 0.16
54 0.12
55 0.14
56 0.2
57 0.26
58 0.27
59 0.27
60 0.29
61 0.33
62 0.34
63 0.33
64 0.31
65 0.27
66 0.28
67 0.3
68 0.34
69 0.32
70 0.35
71 0.4
72 0.39
73 0.37
74 0.36
75 0.35
76 0.29
77 0.3
78 0.28
79 0.24
80 0.21
81 0.21
82 0.19
83 0.18
84 0.17
85 0.16
86 0.15
87 0.12
88 0.1
89 0.1
90 0.08
91 0.09
92 0.09
93 0.09
94 0.12
95 0.12
96 0.16
97 0.22
98 0.26
99 0.33
100 0.42
101 0.51
102 0.56
103 0.66
104 0.65
105 0.68
106 0.74
107 0.73
108 0.74
109 0.75
110 0.75
111 0.75
112 0.83
113 0.82
114 0.75
115 0.71
116 0.62
117 0.59
118 0.58
119 0.52
120 0.46
121 0.42
122 0.39
123 0.38
124 0.36
125 0.29
126 0.22
127 0.2
128 0.15
129 0.11
130 0.11
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.1
138 0.09
139 0.08
140 0.08
141 0.1
142 0.1
143 0.1
144 0.09
145 0.1
146 0.1
147 0.11
148 0.1
149 0.08
150 0.07
151 0.06
152 0.05
153 0.05
154 0.06
155 0.05
156 0.06
157 0.08
158 0.09
159 0.1
160 0.11
161 0.12
162 0.15
163 0.22
164 0.28
165 0.37
166 0.46
167 0.53
168 0.58
169 0.63
170 0.63
171 0.6
172 0.59
173 0.56
174 0.5
175 0.42
176 0.37
177 0.31
178 0.27
179 0.22
180 0.17
181 0.1
182 0.05
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.06
192 0.07
193 0.1
194 0.11
195 0.14
196 0.18
197 0.18
198 0.22
199 0.22
200 0.24
201 0.24
202 0.25
203 0.23
204 0.21
205 0.25
206 0.26
207 0.28
208 0.33
209 0.32
210 0.33
211 0.37
212 0.38
213 0.35
214 0.32
215 0.32
216 0.26
217 0.26
218 0.3
219 0.3
220 0.28
221 0.3
222 0.28
223 0.27
224 0.26
225 0.27
226 0.22
227 0.2
228 0.18
229 0.16
230 0.2
231 0.21
232 0.22
233 0.2
234 0.2
235 0.2
236 0.25
237 0.27
238 0.25
239 0.24
240 0.25
241 0.23
242 0.23
243 0.21
244 0.16
245 0.13
246 0.1
247 0.1
248 0.08
249 0.08
250 0.08
251 0.07
252 0.07
253 0.08
254 0.09
255 0.09
256 0.12
257 0.16
258 0.24
259 0.24
260 0.25
261 0.25
262 0.24
263 0.31
264 0.28
265 0.28
266 0.23
267 0.24
268 0.24
269 0.25
270 0.27
271 0.24
272 0.3
273 0.27
274 0.3
275 0.3
276 0.29
277 0.28
278 0.27
279 0.26
280 0.19
281 0.19
282 0.15
283 0.15
284 0.15
285 0.14
286 0.14
287 0.11
288 0.12
289 0.12
290 0.1
291 0.09
292 0.1
293 0.11
294 0.13
295 0.14
296 0.15
297 0.16
298 0.18
299 0.18
300 0.24
301 0.28
302 0.28
303 0.34
304 0.39
305 0.46
306 0.5
307 0.56
308 0.5
309 0.49
310 0.45
311 0.39
312 0.35
313 0.29
314 0.24
315 0.18
316 0.16
317 0.15
318 0.15
319 0.15
320 0.11
321 0.11
322 0.15
323 0.14
324 0.15
325 0.15
326 0.16
327 0.16
328 0.15
329 0.15
330 0.16
331 0.18
332 0.22
333 0.21
334 0.21
335 0.26
336 0.26
337 0.28
338 0.25
339 0.29
340 0.27
341 0.36
342 0.4
343 0.39
344 0.47
345 0.52
346 0.57
347 0.61
348 0.69
349 0.71
350 0.77
351 0.82
352 0.85
353 0.89
354 0.91
355 0.93
356 0.92
357 0.93
358 0.88
359 0.88
360 0.87
361 0.83
362 0.8
363 0.8
364 0.8
365 0.77
366 0.77
367 0.76
368 0.76
369 0.79
370 0.82
371 0.82
372 0.82