Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KPQ5

Protein Details
Accession K0KPQ5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-57NAEWWPWKPKPKPSPSPSPSHydrophilic
73-94KPSPSPKPSPSPKPKPKSTEPFHydrophilic
NLS Segment(s)
PositionSequence
45-89KPKPKPSPSPSPSPSPSPSPSPSPSPSPKPSPSPKPSPSPKPKPK
Subcellular Location(s) extr 23, mito 1, cyto 1, E.R. 1, vacu 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MLLKNLIFTLFAATSFVQAYPIADTESAEVAEGGDDANAEWWPWKPKPKPSPSPSPSPSPSPSPSPSPSPSPKPSPSPKPSPSPKPKPKSTEPFGLVTIASGSDLQYQSVVVSHGELFLSGNSEDPYRFVGQLWDDGSLQVLPDPSRWVQQSSQGGLFLSVNETSGDFVISDKKDPSFSIKDGHLLYKGKDGVVATPDDRYGYTNTIKAKSDDKKAKYVVLRTVGKDGDTIDDFPPSKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.11
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.11
11 0.11
12 0.11
13 0.12
14 0.11
15 0.1
16 0.09
17 0.07
18 0.07
19 0.07
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.05
27 0.06
28 0.09
29 0.16
30 0.21
31 0.31
32 0.36
33 0.47
34 0.57
35 0.66
36 0.74
37 0.75
38 0.82
39 0.76
40 0.8
41 0.73
42 0.7
43 0.63
44 0.58
45 0.55
46 0.49
47 0.48
48 0.44
49 0.44
50 0.42
51 0.42
52 0.42
53 0.42
54 0.43
55 0.46
56 0.48
57 0.5
58 0.51
59 0.52
60 0.54
61 0.59
62 0.62
63 0.63
64 0.64
65 0.63
66 0.65
67 0.7
68 0.72
69 0.75
70 0.76
71 0.79
72 0.78
73 0.82
74 0.8
75 0.81
76 0.79
77 0.74
78 0.71
79 0.63
80 0.56
81 0.49
82 0.42
83 0.32
84 0.23
85 0.18
86 0.1
87 0.07
88 0.05
89 0.05
90 0.07
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.06
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.09
114 0.09
115 0.09
116 0.09
117 0.1
118 0.1
119 0.13
120 0.13
121 0.11
122 0.11
123 0.1
124 0.11
125 0.09
126 0.08
127 0.06
128 0.07
129 0.06
130 0.06
131 0.09
132 0.1
133 0.13
134 0.14
135 0.16
136 0.16
137 0.23
138 0.26
139 0.26
140 0.26
141 0.23
142 0.22
143 0.2
144 0.19
145 0.12
146 0.1
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.05
155 0.06
156 0.11
157 0.12
158 0.14
159 0.14
160 0.15
161 0.16
162 0.17
163 0.24
164 0.23
165 0.24
166 0.26
167 0.25
168 0.28
169 0.29
170 0.3
171 0.28
172 0.25
173 0.25
174 0.28
175 0.28
176 0.23
177 0.24
178 0.22
179 0.19
180 0.2
181 0.21
182 0.15
183 0.16
184 0.16
185 0.15
186 0.15
187 0.15
188 0.15
189 0.17
190 0.19
191 0.22
192 0.26
193 0.29
194 0.31
195 0.31
196 0.37
197 0.39
198 0.47
199 0.53
200 0.53
201 0.58
202 0.58
203 0.63
204 0.61
205 0.6
206 0.57
207 0.57
208 0.57
209 0.51
210 0.55
211 0.48
212 0.42
213 0.37
214 0.3
215 0.27
216 0.24
217 0.24
218 0.19
219 0.24
220 0.25