Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KBL1

Protein Details
Accession K0KBL1   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
256-275VMIDWYKRAKRAKSNNSSVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 7.5, cyto 7.5, extr 7, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR028939  P5C_Rdtase_cat_N  
Pfam View protein in Pfam  
PF03807  F420_oxidored  
Amino Acid Sequences METIGFIGAGLIGGGIAQLAIKGGYKVLLTNSRDPKSLDPIIKELGDNSRAGSFKDLITDDIKIIVLSVPLKAIPKIFETGEIKDKIILDTSNYYTFRDGQIKELDDRLLTTSEYVSQYIGESNKLVKVFNNIDAIHLRISSTNDLSRQTILPISSNDVDARQLATDFIQKIGFKVLDVGGLSNSWKFEPHTPFYLTPYIPKFPENLDHDDLKSAFQSYPSPSLTVEDGIILLNSATRDGPVGGSIDTTPELVLEVMIDWYKRAKRAKSNNSSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.08
13 0.09
14 0.14
15 0.22
16 0.26
17 0.35
18 0.43
19 0.44
20 0.46
21 0.47
22 0.46
23 0.46
24 0.48
25 0.44
26 0.38
27 0.39
28 0.4
29 0.39
30 0.35
31 0.29
32 0.27
33 0.25
34 0.21
35 0.19
36 0.2
37 0.2
38 0.21
39 0.22
40 0.18
41 0.17
42 0.2
43 0.19
44 0.18
45 0.19
46 0.19
47 0.15
48 0.15
49 0.15
50 0.11
51 0.1
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.13
63 0.15
64 0.15
65 0.19
66 0.21
67 0.23
68 0.29
69 0.28
70 0.27
71 0.26
72 0.26
73 0.21
74 0.2
75 0.17
76 0.12
77 0.14
78 0.17
79 0.2
80 0.2
81 0.2
82 0.2
83 0.21
84 0.21
85 0.24
86 0.22
87 0.22
88 0.25
89 0.26
90 0.26
91 0.26
92 0.23
93 0.17
94 0.17
95 0.15
96 0.11
97 0.1
98 0.09
99 0.08
100 0.1
101 0.11
102 0.1
103 0.09
104 0.08
105 0.09
106 0.1
107 0.11
108 0.08
109 0.08
110 0.09
111 0.11
112 0.11
113 0.11
114 0.1
115 0.14
116 0.16
117 0.18
118 0.21
119 0.18
120 0.19
121 0.2
122 0.2
123 0.15
124 0.13
125 0.11
126 0.08
127 0.1
128 0.1
129 0.11
130 0.11
131 0.12
132 0.14
133 0.14
134 0.14
135 0.13
136 0.12
137 0.12
138 0.11
139 0.11
140 0.11
141 0.13
142 0.12
143 0.13
144 0.12
145 0.11
146 0.11
147 0.1
148 0.1
149 0.07
150 0.07
151 0.06
152 0.07
153 0.1
154 0.1
155 0.1
156 0.12
157 0.12
158 0.12
159 0.15
160 0.14
161 0.1
162 0.12
163 0.11
164 0.1
165 0.1
166 0.1
167 0.07
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.08
174 0.1
175 0.17
176 0.22
177 0.26
178 0.29
179 0.33
180 0.33
181 0.36
182 0.39
183 0.32
184 0.31
185 0.31
186 0.3
187 0.27
188 0.27
189 0.25
190 0.22
191 0.3
192 0.3
193 0.32
194 0.33
195 0.34
196 0.33
197 0.35
198 0.33
199 0.26
200 0.22
201 0.17
202 0.14
203 0.14
204 0.16
205 0.17
206 0.22
207 0.22
208 0.22
209 0.2
210 0.22
211 0.22
212 0.19
213 0.16
214 0.11
215 0.1
216 0.09
217 0.09
218 0.07
219 0.05
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.08
227 0.09
228 0.08
229 0.1
230 0.09
231 0.1
232 0.1
233 0.11
234 0.11
235 0.11
236 0.09
237 0.08
238 0.09
239 0.07
240 0.07
241 0.06
242 0.05
243 0.07
244 0.08
245 0.08
246 0.09
247 0.16
248 0.2
249 0.27
250 0.34
251 0.41
252 0.51
253 0.62
254 0.73
255 0.77