Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KSE1

Protein Details
Accession K0KSE1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
286-315VGQGQSLRQSKKRKDTKSHESPKPKVQSPEHydrophilic
NLS Segment(s)
PositionSequence
297-299KRK
Subcellular Location(s) nucl 12, cyto_nucl 11.833, cyto 10.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR004854  Ufd1-like  
IPR042299  Ufd1-like_Nn  
Gene Ontology GO:0050896  P:response to stimulus  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF03152  UFD1  
Amino Acid Sequences MMPDSTRKDDANFGGKIFLPPSALNRLTMLHIRYPMLFELKNEDQGLKTHSGVLEFVAEEGRVYLPQWMMSTLQLKPGAIIKITNSDVPLGKFVKIEPQSVDFLDISDPKAVLENVLRKFSTLSVNDIIEINYNDKIYGIKVLEAKPESDSNSICVIETDLETDFAPPVGYVEPDYSKNTTSKSKESAKPSAGKPLGTMAKSINYKELAQKASQEISSFKGDGVKLSGKASKPKSAEKKLEELDLNFDGPPARLELPDGQLFFGFPLVPVPNDENSQEEQKPSAFVGQGQSLRQSKKRKDTKSHESPKPKVQSPEVIEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.32
4 0.27
5 0.22
6 0.17
7 0.17
8 0.21
9 0.27
10 0.27
11 0.25
12 0.26
13 0.26
14 0.27
15 0.31
16 0.29
17 0.25
18 0.27
19 0.27
20 0.27
21 0.28
22 0.27
23 0.27
24 0.24
25 0.21
26 0.27
27 0.28
28 0.32
29 0.3
30 0.29
31 0.25
32 0.26
33 0.3
34 0.25
35 0.23
36 0.21
37 0.2
38 0.2
39 0.19
40 0.17
41 0.14
42 0.11
43 0.11
44 0.09
45 0.08
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.15
58 0.18
59 0.15
60 0.21
61 0.2
62 0.19
63 0.19
64 0.22
65 0.21
66 0.18
67 0.18
68 0.14
69 0.18
70 0.2
71 0.2
72 0.16
73 0.17
74 0.18
75 0.18
76 0.21
77 0.17
78 0.17
79 0.16
80 0.16
81 0.23
82 0.23
83 0.25
84 0.22
85 0.24
86 0.24
87 0.24
88 0.26
89 0.17
90 0.15
91 0.15
92 0.14
93 0.12
94 0.12
95 0.11
96 0.09
97 0.11
98 0.1
99 0.1
100 0.13
101 0.18
102 0.2
103 0.22
104 0.22
105 0.21
106 0.22
107 0.22
108 0.25
109 0.19
110 0.2
111 0.2
112 0.2
113 0.2
114 0.2
115 0.18
116 0.13
117 0.13
118 0.11
119 0.1
120 0.09
121 0.09
122 0.09
123 0.09
124 0.08
125 0.1
126 0.09
127 0.1
128 0.13
129 0.14
130 0.18
131 0.18
132 0.18
133 0.17
134 0.18
135 0.18
136 0.16
137 0.16
138 0.14
139 0.15
140 0.14
141 0.12
142 0.11
143 0.1
144 0.08
145 0.08
146 0.07
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.06
153 0.05
154 0.04
155 0.05
156 0.05
157 0.05
158 0.05
159 0.07
160 0.08
161 0.1
162 0.12
163 0.13
164 0.14
165 0.15
166 0.17
167 0.22
168 0.24
169 0.26
170 0.31
171 0.38
172 0.42
173 0.48
174 0.51
175 0.49
176 0.51
177 0.48
178 0.52
179 0.45
180 0.39
181 0.33
182 0.33
183 0.32
184 0.26
185 0.26
186 0.18
187 0.22
188 0.24
189 0.24
190 0.21
191 0.19
192 0.2
193 0.24
194 0.28
195 0.25
196 0.24
197 0.25
198 0.25
199 0.25
200 0.24
201 0.2
202 0.16
203 0.18
204 0.19
205 0.17
206 0.15
207 0.17
208 0.16
209 0.16
210 0.19
211 0.18
212 0.17
213 0.19
214 0.24
215 0.22
216 0.31
217 0.34
218 0.37
219 0.38
220 0.47
221 0.54
222 0.59
223 0.65
224 0.61
225 0.65
226 0.6
227 0.61
228 0.54
229 0.45
230 0.4
231 0.33
232 0.3
233 0.22
234 0.2
235 0.16
236 0.14
237 0.13
238 0.12
239 0.11
240 0.1
241 0.13
242 0.16
243 0.2
244 0.22
245 0.22
246 0.2
247 0.19
248 0.19
249 0.16
250 0.14
251 0.09
252 0.06
253 0.09
254 0.1
255 0.1
256 0.13
257 0.16
258 0.17
259 0.19
260 0.2
261 0.2
262 0.22
263 0.28
264 0.27
265 0.25
266 0.25
267 0.24
268 0.24
269 0.22
270 0.22
271 0.17
272 0.18
273 0.2
274 0.25
275 0.27
276 0.26
277 0.33
278 0.35
279 0.4
280 0.46
281 0.53
282 0.56
283 0.64
284 0.73
285 0.76
286 0.81
287 0.86
288 0.89
289 0.9
290 0.91
291 0.9
292 0.91
293 0.87
294 0.86
295 0.85
296 0.81
297 0.77
298 0.72
299 0.71
300 0.67