Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KLQ4

Protein Details
Accession K0KLQ4   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
86-110NPEKYAKKMMRQSNRQKIKHSNFMAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFTFKRLLVQIPRRQFSTSLVFRAESEAAKEASNLKIKSSCEAGTVLNLKVKKSGAEPVALEDHEYPEWLWEILDPKKQLENLKANPEKYAKKMMRQSNRQKIKHSNFMAKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.47
4 0.47
5 0.41
6 0.35
7 0.34
8 0.32
9 0.3
10 0.33
11 0.29
12 0.2
13 0.18
14 0.17
15 0.16
16 0.16
17 0.16
18 0.15
19 0.18
20 0.24
21 0.22
22 0.21
23 0.25
24 0.25
25 0.27
26 0.27
27 0.23
28 0.17
29 0.19
30 0.17
31 0.16
32 0.18
33 0.16
34 0.16
35 0.17
36 0.15
37 0.16
38 0.16
39 0.14
40 0.13
41 0.17
42 0.15
43 0.16
44 0.16
45 0.16
46 0.17
47 0.16
48 0.16
49 0.11
50 0.12
51 0.1
52 0.1
53 0.08
54 0.07
55 0.08
56 0.07
57 0.07
58 0.06
59 0.11
60 0.13
61 0.18
62 0.18
63 0.19
64 0.22
65 0.26
66 0.28
67 0.32
68 0.38
69 0.39
70 0.48
71 0.52
72 0.5
73 0.51
74 0.53
75 0.49
76 0.44
77 0.5
78 0.43
79 0.46
80 0.55
81 0.61
82 0.65
83 0.72
84 0.79
85 0.8
86 0.87
87 0.82
88 0.82
89 0.83
90 0.81
91 0.81
92 0.77
93 0.76