Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KIX7

Protein Details
Accession K0KIX7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRKRKSAREKRLDNFRSNRSNHydrophilic
NLS Segment(s)
PositionSequence
4-11KRKSAREK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MGRKRKSAREKRLDNFRSNRSNYLDSTENKKKKMGHKVDVDDKVANSSDKQSLNKSNVENDHEKQNKQKSDNKKVLIYRLISDNKEKLMQNVKSEMVKSSLDIDIRNFYKGLEHGTIEYFKKNFYEFIEDFLMMYIDPEVRHTEDLEIDIIHFVKLVFFIKKNPFIRPYIDNLQYIDTTDTNLIGCFKNMKPKSNFSSKFDDDILREKFIKCENELLDKLKEKRNELSDYDFTTEIKELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.79
5 0.74
6 0.71
7 0.66
8 0.63
9 0.54
10 0.51
11 0.49
12 0.42
13 0.48
14 0.52
15 0.52
16 0.5
17 0.54
18 0.55
19 0.58
20 0.66
21 0.66
22 0.65
23 0.68
24 0.74
25 0.78
26 0.76
27 0.7
28 0.6
29 0.5
30 0.44
31 0.36
32 0.29
33 0.21
34 0.2
35 0.22
36 0.24
37 0.26
38 0.29
39 0.35
40 0.38
41 0.42
42 0.4
43 0.41
44 0.42
45 0.46
46 0.45
47 0.4
48 0.46
49 0.46
50 0.46
51 0.48
52 0.52
53 0.53
54 0.53
55 0.6
56 0.6
57 0.66
58 0.73
59 0.68
60 0.66
61 0.62
62 0.62
63 0.59
64 0.5
65 0.41
66 0.4
67 0.4
68 0.35
69 0.36
70 0.32
71 0.28
72 0.31
73 0.29
74 0.26
75 0.31
76 0.32
77 0.31
78 0.32
79 0.32
80 0.29
81 0.29
82 0.26
83 0.19
84 0.17
85 0.14
86 0.14
87 0.14
88 0.14
89 0.13
90 0.14
91 0.16
92 0.16
93 0.17
94 0.14
95 0.12
96 0.13
97 0.13
98 0.15
99 0.12
100 0.11
101 0.11
102 0.12
103 0.15
104 0.14
105 0.16
106 0.12
107 0.11
108 0.12
109 0.12
110 0.12
111 0.11
112 0.18
113 0.16
114 0.19
115 0.21
116 0.2
117 0.19
118 0.18
119 0.16
120 0.08
121 0.08
122 0.05
123 0.04
124 0.04
125 0.06
126 0.08
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.11
133 0.1
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.06
140 0.05
141 0.05
142 0.06
143 0.08
144 0.1
145 0.1
146 0.17
147 0.22
148 0.31
149 0.33
150 0.37
151 0.38
152 0.39
153 0.42
154 0.39
155 0.4
156 0.39
157 0.4
158 0.36
159 0.34
160 0.33
161 0.29
162 0.27
163 0.22
164 0.15
165 0.13
166 0.12
167 0.12
168 0.1
169 0.1
170 0.11
171 0.09
172 0.1
173 0.13
174 0.15
175 0.25
176 0.28
177 0.37
178 0.4
179 0.47
180 0.53
181 0.6
182 0.63
183 0.57
184 0.63
185 0.57
186 0.55
187 0.5
188 0.46
189 0.38
190 0.41
191 0.39
192 0.34
193 0.33
194 0.31
195 0.32
196 0.35
197 0.37
198 0.32
199 0.36
200 0.35
201 0.41
202 0.43
203 0.43
204 0.43
205 0.46
206 0.5
207 0.5
208 0.52
209 0.49
210 0.54
211 0.56
212 0.56
213 0.53
214 0.55
215 0.52
216 0.51
217 0.5
218 0.42
219 0.36
220 0.33