Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KZI5

Protein Details
Accession K0KZI5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
98-121VKNVNDCKTNKKKFNYHPPWGCDSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKLSTVLVQGLLLSGIIASPVVTTAQDSLPDVVEDSNADNSTDSFTEEGYSPGSNYLCFDANKGKLCTGKSVASCEKHYESRGKDIANSLCSFYCSKVKNVNDCKTNKKKFNYHPPWGCDSAAYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.05
11 0.07
12 0.08
13 0.09
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.08
23 0.1
24 0.09
25 0.1
26 0.09
27 0.09
28 0.11
29 0.1
30 0.1
31 0.08
32 0.07
33 0.08
34 0.08
35 0.09
36 0.08
37 0.08
38 0.07
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.11
47 0.15
48 0.17
49 0.21
50 0.21
51 0.21
52 0.22
53 0.22
54 0.24
55 0.22
56 0.23
57 0.2
58 0.25
59 0.29
60 0.29
61 0.3
62 0.3
63 0.31
64 0.3
65 0.32
66 0.33
67 0.3
68 0.35
69 0.36
70 0.32
71 0.31
72 0.34
73 0.34
74 0.31
75 0.29
76 0.24
77 0.21
78 0.23
79 0.22
80 0.19
81 0.23
82 0.22
83 0.25
84 0.33
85 0.38
86 0.46
87 0.55
88 0.6
89 0.62
90 0.65
91 0.71
92 0.73
93 0.77
94 0.76
95 0.75
96 0.77
97 0.79
98 0.86
99 0.86
100 0.86
101 0.84
102 0.82
103 0.8
104 0.73
105 0.63