Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S2V8

Protein Details
Accession E3S2V8   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
341-361LTAGGRRKKRKGAKTSTSSYSHydrophilic
439-464FLGSHHTQGKRRVKKGKQQSGLEQLEHydrophilic
NLS Segment(s)
PositionSequence
345-354GRRKKRKGAK
449-453RRVKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007307  Ltv1  
Gene Ontology GO:0042274  P:ribosomal small subunit biogenesis  
KEGG pte:PTT_16709  -  
Pfam View protein in Pfam  
PF04180  LTV  
Amino Acid Sequences MARGKFIDKKTATNFRLVHRAQNDPRIHDDDAPQMVFAETVAPNQREQPEAAGSSRASQYSAATGRSKIKSRRDLESEYASKVRRNEGEAANYGIYYDDTEYDYMQHMRDLGSGGGEAYFVDAKPEKKGKQKMDLADMLRDASLNDSRSQADLSVSSNISSVSDMFGEDMAPSEFVRKTTYQDQQNIPDALAGFQPDMDPRLREVLEALEDEAYVDDEEDIFNELAQDGYEVDQREWDGAGYDEDDRDPMDRFLDEEDPGWETDDTIKASSPKLKAKKTSDESADPSALPAHDEAPAAADASDMAYLKEFKKFKEDVKAAKPNTPAQPTDSQSFITGASALTAGGRRKKRKGAKTSTSSYSMSSSALHRTEGLTLLDQRFDKIEEEYADDGGFEFPDDASMMSGMSKMSGLSKMSGVSQWSSSEAPPLRSDFDSIMDDFLGSHHTQGKRRVKKGKQQSGLEQLEEVRKGLGAPKIAPKDHFSVLRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.63
4 0.56
5 0.56
6 0.5
7 0.58
8 0.56
9 0.62
10 0.62
11 0.56
12 0.61
13 0.57
14 0.55
15 0.49
16 0.46
17 0.43
18 0.42
19 0.38
20 0.31
21 0.27
22 0.24
23 0.2
24 0.17
25 0.14
26 0.1
27 0.14
28 0.21
29 0.21
30 0.22
31 0.28
32 0.3
33 0.28
34 0.29
35 0.28
36 0.26
37 0.27
38 0.28
39 0.25
40 0.23
41 0.25
42 0.26
43 0.22
44 0.19
45 0.17
46 0.17
47 0.21
48 0.23
49 0.23
50 0.23
51 0.26
52 0.33
53 0.38
54 0.46
55 0.48
56 0.55
57 0.61
58 0.63
59 0.68
60 0.67
61 0.68
62 0.65
63 0.66
64 0.58
65 0.52
66 0.53
67 0.46
68 0.43
69 0.4
70 0.42
71 0.35
72 0.37
73 0.4
74 0.39
75 0.43
76 0.41
77 0.41
78 0.35
79 0.31
80 0.27
81 0.2
82 0.16
83 0.11
84 0.1
85 0.08
86 0.09
87 0.1
88 0.1
89 0.11
90 0.13
91 0.13
92 0.13
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.1
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.09
109 0.12
110 0.13
111 0.21
112 0.28
113 0.32
114 0.4
115 0.5
116 0.53
117 0.6
118 0.66
119 0.63
120 0.63
121 0.64
122 0.56
123 0.5
124 0.43
125 0.34
126 0.27
127 0.22
128 0.15
129 0.13
130 0.14
131 0.13
132 0.14
133 0.15
134 0.16
135 0.17
136 0.17
137 0.14
138 0.12
139 0.11
140 0.12
141 0.13
142 0.13
143 0.12
144 0.12
145 0.11
146 0.11
147 0.1
148 0.08
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.06
157 0.05
158 0.06
159 0.06
160 0.08
161 0.09
162 0.1
163 0.13
164 0.13
165 0.17
166 0.24
167 0.32
168 0.35
169 0.41
170 0.43
171 0.44
172 0.48
173 0.44
174 0.37
175 0.3
176 0.24
177 0.19
178 0.16
179 0.12
180 0.07
181 0.07
182 0.07
183 0.06
184 0.08
185 0.08
186 0.08
187 0.09
188 0.12
189 0.12
190 0.12
191 0.12
192 0.11
193 0.12
194 0.11
195 0.11
196 0.07
197 0.07
198 0.07
199 0.06
200 0.06
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.06
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.03
216 0.04
217 0.07
218 0.08
219 0.08
220 0.08
221 0.08
222 0.09
223 0.08
224 0.07
225 0.05
226 0.05
227 0.05
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.07
236 0.06
237 0.07
238 0.06
239 0.07
240 0.09
241 0.11
242 0.1
243 0.09
244 0.1
245 0.1
246 0.1
247 0.11
248 0.09
249 0.07
250 0.08
251 0.1
252 0.1
253 0.09
254 0.1
255 0.1
256 0.12
257 0.17
258 0.2
259 0.26
260 0.33
261 0.37
262 0.44
263 0.49
264 0.57
265 0.57
266 0.59
267 0.55
268 0.51
269 0.5
270 0.45
271 0.4
272 0.3
273 0.25
274 0.2
275 0.16
276 0.13
277 0.1
278 0.08
279 0.08
280 0.08
281 0.08
282 0.08
283 0.08
284 0.08
285 0.07
286 0.06
287 0.05
288 0.05
289 0.06
290 0.05
291 0.05
292 0.05
293 0.07
294 0.08
295 0.15
296 0.16
297 0.16
298 0.24
299 0.26
300 0.3
301 0.38
302 0.43
303 0.43
304 0.52
305 0.6
306 0.54
307 0.57
308 0.56
309 0.51
310 0.53
311 0.49
312 0.41
313 0.37
314 0.41
315 0.39
316 0.38
317 0.33
318 0.27
319 0.24
320 0.23
321 0.18
322 0.12
323 0.1
324 0.08
325 0.07
326 0.06
327 0.05
328 0.06
329 0.09
330 0.12
331 0.2
332 0.28
333 0.35
334 0.41
335 0.52
336 0.61
337 0.68
338 0.75
339 0.78
340 0.8
341 0.81
342 0.81
343 0.75
344 0.7
345 0.6
346 0.5
347 0.42
348 0.32
349 0.25
350 0.2
351 0.18
352 0.19
353 0.19
354 0.18
355 0.16
356 0.17
357 0.17
358 0.18
359 0.17
360 0.14
361 0.18
362 0.18
363 0.21
364 0.21
365 0.2
366 0.19
367 0.19
368 0.18
369 0.15
370 0.18
371 0.16
372 0.2
373 0.2
374 0.19
375 0.17
376 0.16
377 0.15
378 0.12
379 0.1
380 0.07
381 0.06
382 0.05
383 0.06
384 0.07
385 0.06
386 0.06
387 0.06
388 0.06
389 0.06
390 0.07
391 0.06
392 0.06
393 0.06
394 0.06
395 0.08
396 0.1
397 0.11
398 0.12
399 0.13
400 0.14
401 0.15
402 0.16
403 0.17
404 0.16
405 0.16
406 0.16
407 0.18
408 0.19
409 0.17
410 0.24
411 0.25
412 0.26
413 0.27
414 0.29
415 0.3
416 0.29
417 0.31
418 0.24
419 0.25
420 0.25
421 0.22
422 0.21
423 0.17
424 0.16
425 0.14
426 0.13
427 0.14
428 0.11
429 0.13
430 0.19
431 0.24
432 0.3
433 0.41
434 0.51
435 0.57
436 0.67
437 0.75
438 0.78
439 0.83
440 0.89
441 0.9
442 0.88
443 0.85
444 0.84
445 0.84
446 0.77
447 0.68
448 0.58
449 0.51
450 0.47
451 0.41
452 0.32
453 0.22
454 0.19
455 0.19
456 0.22
457 0.23
458 0.21
459 0.24
460 0.33
461 0.4
462 0.43
463 0.45
464 0.45
465 0.46
466 0.48