FuNGI

E3S2V8

Protein Details

Accession

E3S2V8

Localization Confidence

High

Confidence Score

17.9

NoLS Segment(s)

Position	Sequence	Protein Nature
341-361	LTAGGRRKKRKGAKTSTSSYS	Hydrophilic
439-464	FLGSHHTQGKRRVKKGKQQSGLEQLE	Hydrophilic

NLS Segment(s)

Position	Sequence
345-354	GRRKKRKGAK
449-453	RRVKK

Subcellular Location(s)

nucl 22.5, cyto_nucl 13, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR007307 Ltv1
Gene Ontology	GO:0042274 P:ribosomal small subunit biogenesis
KEGG	pte:PTT_16709 -
Pfam	View protein in Pfam PF04180 LTV

Amino Acid Sequences

MARGKFIDKKTATNFRLVHRAQNDPRIHDDDAPQMVFAETVAPNQREQPEAAGSSRASQYSAATGRSKIKSRRDLESEYASKVRRNEGEAANYGIYYDDTEYDYMQHMRDLGSGGGEAYFVDAKPEKKGKQKMDLADMLRDASLNDSRSQADLSVSSNISSVSDMFGEDMAPSEFVRKTTYQDQQNIPDALAGFQPDMDPRLREVLEALEDEAYVDDEEDIFNELAQDGYEVDQREWDGAGYDEDDRDPMDRFLDEEDPGWETDDTIKASSPKLKAKKTSDESADPSALPAHDEAPAAADASDMAYLKEFKKFKEDVKAAKPNTPAQPTDSQSFITGASALTAGGRRKKRKGAKTSTSSYSMSSSALHRTEGLTLLDQRFDKIEEEYADDGGFEFPDDASMMSGMSKMSGLSKMSGVSQWSSSEAPPLRSDFDSIMDDFLGSHHTQGKRRVKKGKQQSGLEQLEEVRKGLGAPKIAPKDHFSVLRA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.55
3	0.63
4	0.56
5	0.56
6	0.5
7	0.58
8	0.56
9	0.62
10	0.62
11	0.56
12	0.61
13	0.57
14	0.55
15	0.49
16	0.46
17	0.43
18	0.42
19	0.38
20	0.31
21	0.27
22	0.24
23	0.2
24	0.17
25	0.14
26	0.1
27	0.14
28	0.21
29	0.21
30	0.22
31	0.28
32	0.3
33	0.28
34	0.29
35	0.28
36	0.26
37	0.27
38	0.28
39	0.25
40	0.23
41	0.25
42	0.26
43	0.22
44	0.19
45	0.17
46	0.17
47	0.21
48	0.23
49	0.23
50	0.23
51	0.26
52	0.33
53	0.38
54	0.46
55	0.48
56	0.55
57	0.61
58	0.63
59	0.68
60	0.67
61	0.68
62	0.65
63	0.66
64	0.58
65	0.52
66	0.53
67	0.46
68	0.43
69	0.4
70	0.42
71	0.35
72	0.37
73	0.4
74	0.39
75	0.43
76	0.41
77	0.41
78	0.35
79	0.31
80	0.27
81	0.2
82	0.16
83	0.11
84	0.1
85	0.08
86	0.09
87	0.1
88	0.1
89	0.11
90	0.13
91	0.13
92	0.13
93	0.12
94	0.12
95	0.12
96	0.12
97	0.12
98	0.1
99	0.09
100	0.09
101	0.08
102	0.07
103	0.07
104	0.06
105	0.06
106	0.06
107	0.06
108	0.09
109	0.12
110	0.13
111	0.21
112	0.28
113	0.32
114	0.4
115	0.5
116	0.53
117	0.6
118	0.66
119	0.63
120	0.63
121	0.64
122	0.56
123	0.5
124	0.43
125	0.34
126	0.27
127	0.22
128	0.15
129	0.13
130	0.14
131	0.13
132	0.14
133	0.15
134	0.16
135	0.17
136	0.17
137	0.14
138	0.12
139	0.11
140	0.12
141	0.13
142	0.13
143	0.12
144	0.12
145	0.11
146	0.11
147	0.1
148	0.08
149	0.06
150	0.06
151	0.06
152	0.06
153	0.06
154	0.06
155	0.05
156	0.06
157	0.05
158	0.06
159	0.06
160	0.08
161	0.09
162	0.1
163	0.13
164	0.13
165	0.17
166	0.24
167	0.32
168	0.35
169	0.41
170	0.43
171	0.44
172	0.48
173	0.44
174	0.37
175	0.3
176	0.24
177	0.19
178	0.16
179	0.12
180	0.07
181	0.07
182	0.07
183	0.06
184	0.08
185	0.08
186	0.08
187	0.09
188	0.12
189	0.12
190	0.12
191	0.12
192	0.11
193	0.12
194	0.11
195	0.11
196	0.07
197	0.07
198	0.07
199	0.06
200	0.06
201	0.04
202	0.04
203	0.04
204	0.04
205	0.04
206	0.04
207	0.06
208	0.05
209	0.05
210	0.05
211	0.05
212	0.05
213	0.05
214	0.05
215	0.03
216	0.04
217	0.07
218	0.08
219	0.08
220	0.08
221	0.08
222	0.09
223	0.08
224	0.07
225	0.05
226	0.05
227	0.05
228	0.06
229	0.06
230	0.06
231	0.06
232	0.06
233	0.06
234	0.06
235	0.07
236	0.06
237	0.07
238	0.06
239	0.07
240	0.09
241	0.11
242	0.1
243	0.09
244	0.1
245	0.1
246	0.1
247	0.11
248	0.09
249	0.07
250	0.08
251	0.1
252	0.1
253	0.09
254	0.1
255	0.1
256	0.12
257	0.17
258	0.2
259	0.26
260	0.33
261	0.37
262	0.44
263	0.49
264	0.57
265	0.57
266	0.59
267	0.55
268	0.51
269	0.5
270	0.45
271	0.4
272	0.3
273	0.25
274	0.2
275	0.16
276	0.13
277	0.1
278	0.08
279	0.08
280	0.08
281	0.08
282	0.08
283	0.08
284	0.08
285	0.07
286	0.06
287	0.05
288	0.05
289	0.06
290	0.05
291	0.05
292	0.05
293	0.07
294	0.08
295	0.15
296	0.16
297	0.16
298	0.24
299	0.26
300	0.3
301	0.38
302	0.43
303	0.43
304	0.52
305	0.6
306	0.54
307	0.57
308	0.56
309	0.51
310	0.53
311	0.49
312	0.41
313	0.37
314	0.41
315	0.39
316	0.38
317	0.33
318	0.27
319	0.24
320	0.23
321	0.18
322	0.12
323	0.1
324	0.08
325	0.07
326	0.06
327	0.05
328	0.06
329	0.09
330	0.12
331	0.2
332	0.28
333	0.35
334	0.41
335	0.52
336	0.61
337	0.68
338	0.75
339	0.78
340	0.8
341	0.81
342	0.81
343	0.75
344	0.7
345	0.6
346	0.5
347	0.42
348	0.32
349	0.25
350	0.2
351	0.18
352	0.19
353	0.19
354	0.18
355	0.16
356	0.17
357	0.17
358	0.18
359	0.17
360	0.14
361	0.18
362	0.18
363	0.21
364	0.21
365	0.2
366	0.19
367	0.19
368	0.18
369	0.15
370	0.18
371	0.16
372	0.2
373	0.2
374	0.19
375	0.17
376	0.16
377	0.15
378	0.12
379	0.1
380	0.07
381	0.06
382	0.05
383	0.06
384	0.07
385	0.06
386	0.06
387	0.06
388	0.06
389	0.06
390	0.07
391	0.06
392	0.06
393	0.06
394	0.06
395	0.08
396	0.1
397	0.11
398	0.12
399	0.13
400	0.14
401	0.15
402	0.16
403	0.17
404	0.16
405	0.16
406	0.16
407	0.18
408	0.19
409	0.17
410	0.24
411	0.25
412	0.26
413	0.27
414	0.29
415	0.3
416	0.29
417	0.31
418	0.24
419	0.25
420	0.25
421	0.22
422	0.21
423	0.17
424	0.16
425	0.14
426	0.13
427	0.14
428	0.11
429	0.13
430	0.19
431	0.24
432	0.3
433	0.41
434	0.51
435	0.57
436	0.67
437	0.75
438	0.78
439	0.83
440	0.89
441	0.9
442	0.88
443	0.85
444	0.84
445	0.84
446	0.77
447	0.68
448	0.58
449	0.51
450	0.47
451	0.41
452	0.32
453	0.22
454	0.19
455	0.19
456	0.22
457	0.23
458	0.21
459	0.24
460	0.33
461	0.4
462	0.43
463	0.45
464	0.45
465	0.46
466	0.48

E3S2V8

3D AlphaFold-predicted Structure Viewer