Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0K9R9

Protein Details
Accession K0K9R9   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
448-470KLSETPCKWVRKTPKLGEHEAKWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 11.5, nucl 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003673  CoA-Trfase_fam_III  
IPR023606  CoA-Trfase_III_dom_1_sf  
Gene Ontology GO:0033608  F:formyl-CoA transferase activity  
Pfam View protein in Pfam  
PF02515  CoA_transf_3  
Amino Acid Sequences MGAFQELMAIRGVNPPKDEEVHITGSDPIYKTPFKLGETTAQVLAACGVAANDLWELKTGNRQKVSVSVEAAAGGLDEKNNSLAKDNNGQYQRIEGSESMKHMVRMTQPWETADKKWFLPHTNLKHLEERVLKVLECESTVESIQNAISKRNAQELEDSIANANACGGICNTEEEWLKHPQGSYLSSVPVVEIDRLFDSAKESLPDNNDMPLSGIRVLDLTRILAGPVCGLTLAELGADVLMVTAEKLPQVNEFVRDTSHGKRSCFLDLSKDEDASKLKELVKEADIIIDGYRPDRLAAYGFGVEDLAKLRPGLIHVSINCFGSGGPFGSRAGWDQVAQAVTGMCVKQGEAIGSNKPELTPVFACDYVCGRLGAFGAMLALKRRAENGGFYSIQVSLCQAAMLLQRQGYVNNFEDVLGKISEKTYEEYQVFENDTSYGDLKVLGPVLKLSETPCKWVRKTPKLGEHEAKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.31
4 0.33
5 0.35
6 0.34
7 0.35
8 0.35
9 0.33
10 0.31
11 0.3
12 0.28
13 0.3
14 0.24
15 0.21
16 0.23
17 0.24
18 0.25
19 0.3
20 0.32
21 0.3
22 0.33
23 0.34
24 0.36
25 0.4
26 0.41
27 0.34
28 0.31
29 0.29
30 0.25
31 0.22
32 0.14
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.2
46 0.27
47 0.34
48 0.37
49 0.37
50 0.37
51 0.44
52 0.48
53 0.42
54 0.36
55 0.29
56 0.26
57 0.26
58 0.24
59 0.16
60 0.11
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.1
67 0.11
68 0.12
69 0.14
70 0.18
71 0.21
72 0.3
73 0.32
74 0.37
75 0.38
76 0.39
77 0.36
78 0.36
79 0.33
80 0.25
81 0.25
82 0.18
83 0.19
84 0.21
85 0.23
86 0.21
87 0.21
88 0.21
89 0.2
90 0.23
91 0.23
92 0.26
93 0.28
94 0.3
95 0.3
96 0.31
97 0.36
98 0.35
99 0.34
100 0.35
101 0.33
102 0.29
103 0.33
104 0.35
105 0.34
106 0.39
107 0.45
108 0.47
109 0.54
110 0.58
111 0.56
112 0.58
113 0.55
114 0.53
115 0.48
116 0.42
117 0.37
118 0.34
119 0.3
120 0.25
121 0.26
122 0.2
123 0.16
124 0.15
125 0.11
126 0.12
127 0.12
128 0.11
129 0.1
130 0.1
131 0.1
132 0.12
133 0.12
134 0.12
135 0.14
136 0.17
137 0.18
138 0.24
139 0.25
140 0.22
141 0.25
142 0.25
143 0.26
144 0.23
145 0.22
146 0.16
147 0.16
148 0.15
149 0.11
150 0.09
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.09
158 0.09
159 0.11
160 0.13
161 0.14
162 0.17
163 0.2
164 0.2
165 0.2
166 0.2
167 0.19
168 0.2
169 0.2
170 0.2
171 0.17
172 0.16
173 0.15
174 0.15
175 0.13
176 0.12
177 0.1
178 0.08
179 0.07
180 0.08
181 0.08
182 0.09
183 0.09
184 0.08
185 0.1
186 0.1
187 0.11
188 0.1
189 0.11
190 0.12
191 0.14
192 0.17
193 0.15
194 0.15
195 0.14
196 0.13
197 0.14
198 0.11
199 0.1
200 0.09
201 0.08
202 0.07
203 0.07
204 0.08
205 0.07
206 0.07
207 0.06
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.04
214 0.04
215 0.04
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.02
225 0.02
226 0.02
227 0.02
228 0.02
229 0.02
230 0.02
231 0.03
232 0.03
233 0.03
234 0.04
235 0.04
236 0.05
237 0.09
238 0.09
239 0.11
240 0.12
241 0.12
242 0.13
243 0.15
244 0.17
245 0.19
246 0.26
247 0.27
248 0.26
249 0.29
250 0.31
251 0.32
252 0.31
253 0.27
254 0.26
255 0.25
256 0.3
257 0.28
258 0.26
259 0.23
260 0.22
261 0.24
262 0.18
263 0.18
264 0.17
265 0.18
266 0.19
267 0.21
268 0.22
269 0.21
270 0.2
271 0.19
272 0.15
273 0.13
274 0.11
275 0.1
276 0.08
277 0.08
278 0.07
279 0.07
280 0.07
281 0.07
282 0.07
283 0.07
284 0.07
285 0.08
286 0.09
287 0.09
288 0.09
289 0.09
290 0.09
291 0.08
292 0.07
293 0.08
294 0.07
295 0.06
296 0.06
297 0.07
298 0.07
299 0.08
300 0.11
301 0.11
302 0.15
303 0.15
304 0.2
305 0.21
306 0.21
307 0.2
308 0.17
309 0.15
310 0.12
311 0.12
312 0.08
313 0.08
314 0.08
315 0.09
316 0.09
317 0.1
318 0.11
319 0.13
320 0.13
321 0.12
322 0.12
323 0.14
324 0.14
325 0.13
326 0.12
327 0.09
328 0.08
329 0.09
330 0.09
331 0.07
332 0.06
333 0.07
334 0.08
335 0.09
336 0.1
337 0.11
338 0.13
339 0.17
340 0.18
341 0.19
342 0.17
343 0.17
344 0.17
345 0.15
346 0.18
347 0.15
348 0.16
349 0.19
350 0.2
351 0.2
352 0.19
353 0.21
354 0.18
355 0.18
356 0.15
357 0.11
358 0.12
359 0.12
360 0.11
361 0.08
362 0.07
363 0.06
364 0.07
365 0.08
366 0.09
367 0.11
368 0.12
369 0.13
370 0.15
371 0.18
372 0.18
373 0.22
374 0.24
375 0.27
376 0.26
377 0.26
378 0.26
379 0.24
380 0.22
381 0.18
382 0.16
383 0.1
384 0.1
385 0.09
386 0.08
387 0.09
388 0.13
389 0.15
390 0.16
391 0.15
392 0.17
393 0.18
394 0.2
395 0.2
396 0.22
397 0.21
398 0.2
399 0.2
400 0.19
401 0.2
402 0.19
403 0.19
404 0.15
405 0.13
406 0.13
407 0.14
408 0.16
409 0.16
410 0.2
411 0.2
412 0.26
413 0.26
414 0.27
415 0.28
416 0.29
417 0.29
418 0.25
419 0.23
420 0.17
421 0.17
422 0.18
423 0.17
424 0.14
425 0.11
426 0.12
427 0.12
428 0.14
429 0.15
430 0.14
431 0.13
432 0.14
433 0.16
434 0.16
435 0.17
436 0.18
437 0.26
438 0.26
439 0.33
440 0.39
441 0.45
442 0.47
443 0.56
444 0.64
445 0.64
446 0.74
447 0.77
448 0.8
449 0.79
450 0.86