Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RXZ0

Protein Details
Accession E3RXZ0    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-117GHSDKHGKKKEDKVEEKKDEQBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 10.333, cyto 7.5, cyto_nucl 7.333, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
KEGG pte:PTT_14327  -  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MSLDVKGRLRNISPRPTFGQELLSTFGNQIGEIALIPATGGLFSVELTYVPVSVEDGEKVEAKKVLLWDRKTEGGFPETKVLKQRVRDHIDPNRDLGHSDKHGKKKEDKVEEKKDEQGQKELSEGVEVKRNSDGSVCEDCNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.57
4 0.56
5 0.48
6 0.45
7 0.36
8 0.34
9 0.32
10 0.27
11 0.22
12 0.19
13 0.2
14 0.14
15 0.12
16 0.1
17 0.08
18 0.07
19 0.06
20 0.07
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.05
43 0.06
44 0.07
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.11
51 0.14
52 0.21
53 0.26
54 0.27
55 0.29
56 0.3
57 0.33
58 0.31
59 0.29
60 0.23
61 0.19
62 0.19
63 0.16
64 0.2
65 0.18
66 0.19
67 0.23
68 0.27
69 0.28
70 0.34
71 0.41
72 0.45
73 0.51
74 0.54
75 0.57
76 0.6
77 0.64
78 0.58
79 0.51
80 0.44
81 0.37
82 0.35
83 0.29
84 0.26
85 0.23
86 0.31
87 0.36
88 0.43
89 0.5
90 0.55
91 0.61
92 0.65
93 0.7
94 0.72
95 0.76
96 0.77
97 0.8
98 0.82
99 0.77
100 0.75
101 0.73
102 0.69
103 0.61
104 0.58
105 0.5
106 0.43
107 0.42
108 0.36
109 0.28
110 0.24
111 0.23
112 0.18
113 0.23
114 0.22
115 0.23
116 0.25
117 0.26
118 0.23
119 0.24
120 0.24
121 0.23
122 0.3