Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KPF4

Protein Details
Accession K0KPF4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-151KDNNDKIRNKQNKKIGNNDKVKKPKKDKKKSTKBasic
NLS Segment(s)
PositionSequence
125-151IRNKQNKKIGNNDKVKKPKKDKKKSTK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MENEELIKQYITALDASLDDLEPAIKELSAKSFEDRINETSDEHERIKIANGYAYILTSLSFVDTAAAKRFIEAALNNGTGNSTVITGTPEPAISSASFQGKHTKFQQSDNDSDEKNNKDNNDKIRNKQNKKIGNNDKVKKPKKDKKKSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.09
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.07
12 0.06
13 0.07
14 0.08
15 0.12
16 0.15
17 0.16
18 0.17
19 0.22
20 0.23
21 0.26
22 0.29
23 0.27
24 0.28
25 0.27
26 0.25
27 0.24
28 0.26
29 0.26
30 0.24
31 0.22
32 0.19
33 0.19
34 0.21
35 0.19
36 0.16
37 0.14
38 0.13
39 0.14
40 0.13
41 0.13
42 0.1
43 0.08
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.06
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.09
59 0.1
60 0.09
61 0.1
62 0.11
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.06
70 0.04
71 0.04
72 0.04
73 0.06
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.06
82 0.08
83 0.09
84 0.12
85 0.13
86 0.13
87 0.23
88 0.23
89 0.28
90 0.31
91 0.38
92 0.37
93 0.43
94 0.51
95 0.47
96 0.5
97 0.49
98 0.47
99 0.39
100 0.41
101 0.4
102 0.35
103 0.34
104 0.34
105 0.32
106 0.36
107 0.42
108 0.48
109 0.54
110 0.57
111 0.6
112 0.67
113 0.75
114 0.76
115 0.79
116 0.78
117 0.77
118 0.78
119 0.82
120 0.81
121 0.81
122 0.84
123 0.83
124 0.83
125 0.85
126 0.87
127 0.86
128 0.87
129 0.87
130 0.88
131 0.92