Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KSC5

Protein Details
Accession K0KSC5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-162ADDRREKDRMKRQARKERKEREKREMLIBasic
NLS Segment(s)
PositionSequence
138-158RREKDRMKRQARKERKEREKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR027113  Transc_fact_NFYB/HAP3  
Gene Ontology GO:0016602  C:CCAAT-binding factor complex  
GO:0004813  F:alanine-tRNA ligase activity  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MNSQYNNYTTQPLPTGVPTQEQEPLTEAEEILFREYEIREQDRWLPLANVGRVMKNGLPSHAKLSKESKECVQECVSEFISFITSGAVDKCQAEKRKTLNGEDILYAMNSLGFENYAETLKIYLAKYREHERLEADDRREKDRMKRQARKERKEREKREMLIASGQLDENSTSTTISGSKSTKQSDNIQDYDDDEEGLDDYEDLDDEEKDNDSNLSAVNEEDEPVDLNDLRYDIDNPTIDQYVLSGNSNEMNVYDESIQFQEQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.24
4 0.28
5 0.26
6 0.26
7 0.3
8 0.28
9 0.26
10 0.24
11 0.24
12 0.21
13 0.21
14 0.18
15 0.13
16 0.15
17 0.14
18 0.14
19 0.12
20 0.1
21 0.12
22 0.13
23 0.17
24 0.21
25 0.24
26 0.23
27 0.26
28 0.32
29 0.33
30 0.34
31 0.31
32 0.26
33 0.26
34 0.31
35 0.29
36 0.29
37 0.27
38 0.26
39 0.25
40 0.27
41 0.25
42 0.25
43 0.25
44 0.23
45 0.26
46 0.26
47 0.33
48 0.35
49 0.34
50 0.32
51 0.38
52 0.42
53 0.42
54 0.43
55 0.41
56 0.45
57 0.45
58 0.45
59 0.4
60 0.35
61 0.33
62 0.34
63 0.3
64 0.21
65 0.2
66 0.16
67 0.16
68 0.13
69 0.11
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.11
78 0.18
79 0.24
80 0.26
81 0.32
82 0.36
83 0.43
84 0.46
85 0.45
86 0.44
87 0.41
88 0.39
89 0.33
90 0.29
91 0.21
92 0.18
93 0.15
94 0.08
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.09
109 0.09
110 0.11
111 0.12
112 0.14
113 0.17
114 0.22
115 0.27
116 0.25
117 0.26
118 0.25
119 0.28
120 0.32
121 0.33
122 0.32
123 0.31
124 0.32
125 0.35
126 0.36
127 0.34
128 0.37
129 0.42
130 0.49
131 0.55
132 0.62
133 0.69
134 0.78
135 0.86
136 0.87
137 0.88
138 0.88
139 0.89
140 0.91
141 0.88
142 0.86
143 0.84
144 0.76
145 0.73
146 0.64
147 0.53
148 0.45
149 0.38
150 0.3
151 0.22
152 0.2
153 0.12
154 0.11
155 0.1
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.08
164 0.11
165 0.13
166 0.17
167 0.22
168 0.25
169 0.28
170 0.31
171 0.38
172 0.43
173 0.47
174 0.44
175 0.41
176 0.37
177 0.35
178 0.34
179 0.26
180 0.17
181 0.11
182 0.1
183 0.09
184 0.09
185 0.08
186 0.04
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.06
194 0.07
195 0.08
196 0.08
197 0.09
198 0.08
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.08
205 0.09
206 0.09
207 0.09
208 0.09
209 0.09
210 0.09
211 0.09
212 0.11
213 0.1
214 0.1
215 0.11
216 0.11
217 0.11
218 0.11
219 0.13
220 0.12
221 0.16
222 0.17
223 0.17
224 0.2
225 0.2
226 0.19
227 0.17
228 0.16
229 0.15
230 0.15
231 0.15
232 0.13
233 0.13
234 0.14
235 0.15
236 0.14
237 0.11
238 0.13
239 0.12
240 0.14
241 0.14
242 0.13
243 0.16
244 0.17