Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KEW0

Protein Details
Accession K0KEW0    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPQKALKVKPKEKKRERITKKQQNPKNYAPKIHydrophilic
NLS Segment(s)
PositionSequence
6-39LKVKPKEKKRERITKKQQNPKNYAPKIIKAKNPK
80-93QQKLEKKKAAEKKK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVKPKEKKRERITKKQQNPKNYAPKIIKAKNPKVAAMDKLSKVHSVTTSTEKLIASRVGHLELLTGSRREIERQQKLEKKKAAEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.92
5 0.93
6 0.92
7 0.92
8 0.92
9 0.89
10 0.87
11 0.85
12 0.84
13 0.83
14 0.74
15 0.72
16 0.66
17 0.66
18 0.65
19 0.63
20 0.6
21 0.59
22 0.64
23 0.63
24 0.61
25 0.55
26 0.49
27 0.46
28 0.42
29 0.37
30 0.34
31 0.27
32 0.27
33 0.27
34 0.23
35 0.21
36 0.19
37 0.15
38 0.14
39 0.15
40 0.18
41 0.19
42 0.19
43 0.2
44 0.19
45 0.18
46 0.17
47 0.18
48 0.13
49 0.14
50 0.15
51 0.14
52 0.15
53 0.14
54 0.13
55 0.1
56 0.12
57 0.12
58 0.11
59 0.1
60 0.13
61 0.14
62 0.18
63 0.26
64 0.34
65 0.42
66 0.48
67 0.59
68 0.64
69 0.72
70 0.78
71 0.76
72 0.74
73 0.74