Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KRZ9

Protein Details
Accession K0KRZ9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-41AMAGGKKSKKKWSKGRVKDKAQHIVIHydrophilic
NLS Segment(s)
PositionSequence
11-34AKAAAAMAGGKKSKKKWSKGRVKD
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGRVKDKAQHIVILDQEKYDKIVKDVPTFRYISVSVLVDRLKVGGSIARQAIQQLEREGQIKRISRHSSQLIYTRASASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.3
10 0.39
11 0.47
12 0.56
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.9
19 0.9
20 0.88
21 0.85
22 0.83
23 0.73
24 0.64
25 0.54
26 0.45
27 0.38
28 0.33
29 0.25
30 0.16
31 0.16
32 0.14
33 0.15
34 0.15
35 0.12
36 0.11
37 0.17
38 0.19
39 0.24
40 0.28
41 0.28
42 0.29
43 0.29
44 0.28
45 0.25
46 0.23
47 0.18
48 0.16
49 0.14
50 0.11
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.11
62 0.12
63 0.12
64 0.12
65 0.13
66 0.16
67 0.15
68 0.17
69 0.16
70 0.17
71 0.18
72 0.2
73 0.21
74 0.22
75 0.27
76 0.31
77 0.32
78 0.39
79 0.44
80 0.45
81 0.52
82 0.53
83 0.5
84 0.49
85 0.53
86 0.48
87 0.45
88 0.43