Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0K7J8

Protein Details
Accession K0K7J8   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
298-339IEKREIEKERNIRRLKRESMRIDDGSNKRRSYRRRYDDLEIRBasic
NLS Segment(s)
PositionSequence
309-314IRRLKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MEKPLLPQGLSTNFHNRVKNDQTALYISAAPTRSTKRAKNVVNYAEYEDLNFDDENDTNYADDGYNNYNSLASVNNTDSALNNTLQGKLAVKTKHLNFSEYEMNFNSLNEEILIPIRINLEHNSNRIVDFFMWNLNETLITPEQFALITCQDMDLPNSYQSQIANSIKSQIEEYTNLVTIQLPKNIDIHVVIELSCNLDKNLYEDKVEWDLTNDAITPEAFARYVVMDLGLSLEFLPAIAHTLHESILKLKKDCIDGRLPQEIYNQSAFGYEAGVRLDHERLGASWVPSVEELSQWEIEKREIEKERNIRRLKRESMRIDDGSNKRRSYRRRYDDLEIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.5
4 0.52
5 0.56
6 0.58
7 0.53
8 0.47
9 0.45
10 0.42
11 0.42
12 0.34
13 0.28
14 0.22
15 0.23
16 0.23
17 0.21
18 0.23
19 0.26
20 0.32
21 0.39
22 0.45
23 0.5
24 0.58
25 0.64
26 0.68
27 0.72
28 0.71
29 0.68
30 0.63
31 0.57
32 0.51
33 0.44
34 0.35
35 0.27
36 0.2
37 0.18
38 0.15
39 0.12
40 0.11
41 0.12
42 0.13
43 0.13
44 0.13
45 0.11
46 0.12
47 0.12
48 0.1
49 0.1
50 0.11
51 0.13
52 0.14
53 0.14
54 0.14
55 0.13
56 0.13
57 0.13
58 0.12
59 0.1
60 0.12
61 0.13
62 0.14
63 0.14
64 0.14
65 0.14
66 0.16
67 0.17
68 0.14
69 0.16
70 0.16
71 0.16
72 0.16
73 0.17
74 0.14
75 0.14
76 0.2
77 0.19
78 0.21
79 0.28
80 0.31
81 0.38
82 0.38
83 0.38
84 0.33
85 0.36
86 0.4
87 0.34
88 0.33
89 0.25
90 0.26
91 0.24
92 0.23
93 0.2
94 0.12
95 0.12
96 0.09
97 0.08
98 0.07
99 0.07
100 0.08
101 0.06
102 0.07
103 0.08
104 0.08
105 0.09
106 0.1
107 0.17
108 0.19
109 0.2
110 0.22
111 0.21
112 0.21
113 0.2
114 0.2
115 0.14
116 0.12
117 0.11
118 0.12
119 0.12
120 0.12
121 0.12
122 0.1
123 0.09
124 0.08
125 0.11
126 0.1
127 0.1
128 0.09
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.15
150 0.15
151 0.15
152 0.14
153 0.17
154 0.17
155 0.17
156 0.17
157 0.12
158 0.12
159 0.12
160 0.14
161 0.11
162 0.11
163 0.11
164 0.1
165 0.1
166 0.12
167 0.12
168 0.14
169 0.13
170 0.13
171 0.15
172 0.14
173 0.14
174 0.11
175 0.1
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.08
182 0.08
183 0.07
184 0.07
185 0.07
186 0.07
187 0.11
188 0.16
189 0.15
190 0.15
191 0.16
192 0.19
193 0.21
194 0.21
195 0.17
196 0.14
197 0.14
198 0.13
199 0.13
200 0.1
201 0.07
202 0.07
203 0.07
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.07
212 0.06
213 0.05
214 0.04
215 0.04
216 0.06
217 0.05
218 0.05
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.03
225 0.05
226 0.05
227 0.05
228 0.06
229 0.07
230 0.08
231 0.09
232 0.09
233 0.13
234 0.2
235 0.23
236 0.23
237 0.25
238 0.28
239 0.34
240 0.36
241 0.36
242 0.37
243 0.39
244 0.43
245 0.47
246 0.44
247 0.39
248 0.43
249 0.39
250 0.35
251 0.31
252 0.26
253 0.19
254 0.19
255 0.18
256 0.12
257 0.12
258 0.08
259 0.08
260 0.09
261 0.09
262 0.1
263 0.11
264 0.13
265 0.11
266 0.11
267 0.11
268 0.11
269 0.15
270 0.17
271 0.15
272 0.16
273 0.16
274 0.17
275 0.16
276 0.18
277 0.13
278 0.12
279 0.13
280 0.15
281 0.16
282 0.16
283 0.18
284 0.18
285 0.2
286 0.23
287 0.23
288 0.29
289 0.34
290 0.38
291 0.46
292 0.54
293 0.62
294 0.68
295 0.75
296 0.74
297 0.77
298 0.81
299 0.82
300 0.81
301 0.82
302 0.8
303 0.79
304 0.79
305 0.72
306 0.66
307 0.65
308 0.65
309 0.64
310 0.63
311 0.58
312 0.57
313 0.64
314 0.7
315 0.71
316 0.73
317 0.73
318 0.76
319 0.8