Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KRR5

Protein Details
Accession K0KRR5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-93HKRFLIWKEKKEKKEQLKKLKEAKKKFKEERKKLKENQTQVGSBasic
NLS Segment(s)
PositionSequence
57-85WKEKKEKKEQLKKLKEAKKKFKEERKKLK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MMILSIMMKDPNPYNLGYWMESMVKSEEQITKEENATLIPPLPFDLLPDTHKRFLIWKEKKEKKEQLKKLKEAKKKFKEERKKLKENQTQVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.24
4 0.22
5 0.21
6 0.19
7 0.18
8 0.17
9 0.17
10 0.16
11 0.14
12 0.13
13 0.15
14 0.17
15 0.17
16 0.19
17 0.19
18 0.19
19 0.19
20 0.19
21 0.16
22 0.12
23 0.11
24 0.1
25 0.1
26 0.08
27 0.07
28 0.08
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.12
35 0.17
36 0.2
37 0.21
38 0.21
39 0.21
40 0.23
41 0.28
42 0.36
43 0.39
44 0.44
45 0.54
46 0.63
47 0.68
48 0.75
49 0.78
50 0.78
51 0.8
52 0.83
53 0.83
54 0.84
55 0.87
56 0.88
57 0.87
58 0.86
59 0.86
60 0.87
61 0.86
62 0.87
63 0.88
64 0.89
65 0.91
66 0.92
67 0.93
68 0.92
69 0.92
70 0.91
71 0.92
72 0.91
73 0.87