Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KK42

Protein Details
Accession K0KK42    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-97SDIKHSKPTWCRPTKPKQQQQESKESEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 2
Family & Domain DBs
Amino Acid Sequences MGITLEQLLKLNDEDEFIAEKARQYEELAREEHKAKNPTSTVIIQNYEQSNQDLWPTLGGATAASNEDASDIKHSKPTWCRPTKPKQQQQESKESEETSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.11
5 0.13
6 0.13
7 0.14
8 0.15
9 0.16
10 0.15
11 0.15
12 0.21
13 0.24
14 0.26
15 0.27
16 0.26
17 0.28
18 0.3
19 0.32
20 0.33
21 0.33
22 0.31
23 0.35
24 0.34
25 0.32
26 0.33
27 0.32
28 0.28
29 0.26
30 0.27
31 0.21
32 0.23
33 0.22
34 0.2
35 0.17
36 0.15
37 0.13
38 0.12
39 0.12
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.11
58 0.12
59 0.13
60 0.18
61 0.19
62 0.26
63 0.34
64 0.44
65 0.5
66 0.57
67 0.65
68 0.7
69 0.79
70 0.84
71 0.86
72 0.85
73 0.85
74 0.88
75 0.89
76 0.87
77 0.87
78 0.82
79 0.77
80 0.71
81 0.62