Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KJ33

Protein Details
Accession K0KJ33    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-52TSDSTLKRRPLKKIKLGKARPAIYHydrophilic
NLS Segment(s)
PositionSequence
35-48KRRPLKKIKLGKAR
178-184KASRRRK
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MFRPTIKSIPNLSILGRRLASGRAPGQATSDSTLKRRPLKKIKLGKARPAIYYQFNCKTELSDGSVIIRRSQYPKDELRLIQDQRNHPLWNPNRVDLEVIDPNAGGRIARFKQKFSQFDIEENIKQDLQQEGQEESNEEALKSEKEEEDLDNLMMDEYLELLGQNVQEVQKGGKVQTKASRRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.29
4 0.26
5 0.23
6 0.24
7 0.24
8 0.24
9 0.25
10 0.25
11 0.26
12 0.26
13 0.27
14 0.26
15 0.26
16 0.23
17 0.25
18 0.22
19 0.24
20 0.3
21 0.34
22 0.41
23 0.46
24 0.53
25 0.6
26 0.68
27 0.75
28 0.8
29 0.83
30 0.85
31 0.86
32 0.84
33 0.83
34 0.75
35 0.67
36 0.61
37 0.54
38 0.5
39 0.47
40 0.45
41 0.43
42 0.41
43 0.41
44 0.37
45 0.35
46 0.3
47 0.28
48 0.25
49 0.19
50 0.18
51 0.18
52 0.22
53 0.2
54 0.19
55 0.19
56 0.17
57 0.2
58 0.23
59 0.24
60 0.25
61 0.29
62 0.31
63 0.34
64 0.32
65 0.33
66 0.38
67 0.36
68 0.34
69 0.37
70 0.35
71 0.36
72 0.38
73 0.34
74 0.27
75 0.34
76 0.34
77 0.38
78 0.37
79 0.34
80 0.32
81 0.32
82 0.32
83 0.23
84 0.23
85 0.15
86 0.14
87 0.12
88 0.1
89 0.1
90 0.1
91 0.09
92 0.05
93 0.04
94 0.1
95 0.11
96 0.2
97 0.21
98 0.23
99 0.31
100 0.4
101 0.43
102 0.43
103 0.5
104 0.43
105 0.44
106 0.46
107 0.42
108 0.35
109 0.34
110 0.29
111 0.21
112 0.2
113 0.19
114 0.16
115 0.14
116 0.14
117 0.14
118 0.15
119 0.16
120 0.16
121 0.15
122 0.14
123 0.16
124 0.14
125 0.12
126 0.12
127 0.12
128 0.12
129 0.13
130 0.15
131 0.12
132 0.14
133 0.16
134 0.16
135 0.18
136 0.18
137 0.17
138 0.14
139 0.14
140 0.12
141 0.1
142 0.08
143 0.05
144 0.04
145 0.05
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.06
152 0.08
153 0.08
154 0.1
155 0.11
156 0.12
157 0.15
158 0.17
159 0.2
160 0.24
161 0.26
162 0.31
163 0.39
164 0.49