Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KZR5

Protein Details
Accession K0KZR5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MDYNIKQENRKKFQDKSKLKRHHKKDYSKVIPKESTHydrophilic
NLS Segment(s)
PositionSequence
10-25RKKFQDKSKLKRHHKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDYNIKQENRKKFQDKSKLKRHHKKDYSKVIPKESTDQNKEEPQQIEETEIEYEDVLDPETDEQGRFVLHGDQYEAINDEGVTVVRRPKIDKTKTNAWRYRDELEILGLDQDDEELLKNIDFKKLNFNKIDSKKDKSSFKDFKKMSNDELRNLKIIDSKFDDPDSTYDKSEDDIDDLERLLSKRSNKSTIKSQQIPHDLSNPSFQSQSQSQPSEKNQNKTPVALKSDEAFLDDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.84
4 0.87
5 0.88
6 0.92
7 0.93
8 0.92
9 0.92
10 0.92
11 0.92
12 0.92
13 0.92
14 0.91
15 0.91
16 0.87
17 0.84
18 0.78
19 0.7
20 0.67
21 0.65
22 0.64
23 0.59
24 0.56
25 0.53
26 0.55
27 0.55
28 0.55
29 0.47
30 0.39
31 0.37
32 0.34
33 0.32
34 0.25
35 0.23
36 0.17
37 0.15
38 0.13
39 0.1
40 0.1
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.1
56 0.1
57 0.1
58 0.11
59 0.12
60 0.12
61 0.12
62 0.13
63 0.09
64 0.09
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.1
72 0.12
73 0.13
74 0.16
75 0.24
76 0.34
77 0.41
78 0.48
79 0.52
80 0.6
81 0.68
82 0.75
83 0.73
84 0.67
85 0.64
86 0.6
87 0.55
88 0.46
89 0.38
90 0.29
91 0.23
92 0.2
93 0.14
94 0.11
95 0.08
96 0.06
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.06
106 0.07
107 0.12
108 0.13
109 0.13
110 0.23
111 0.28
112 0.33
113 0.33
114 0.35
115 0.4
116 0.46
117 0.55
118 0.48
119 0.5
120 0.51
121 0.55
122 0.59
123 0.55
124 0.59
125 0.59
126 0.6
127 0.64
128 0.58
129 0.6
130 0.61
131 0.59
132 0.54
133 0.55
134 0.51
135 0.47
136 0.51
137 0.45
138 0.39
139 0.36
140 0.31
141 0.26
142 0.24
143 0.23
144 0.23
145 0.24
146 0.24
147 0.24
148 0.24
149 0.2
150 0.23
151 0.24
152 0.2
153 0.19
154 0.18
155 0.18
156 0.18
157 0.18
158 0.16
159 0.12
160 0.11
161 0.11
162 0.11
163 0.11
164 0.1
165 0.11
166 0.11
167 0.12
168 0.16
169 0.21
170 0.29
171 0.35
172 0.44
173 0.46
174 0.51
175 0.59
176 0.63
177 0.67
178 0.65
179 0.64
180 0.64
181 0.67
182 0.66
183 0.58
184 0.55
185 0.48
186 0.43
187 0.45
188 0.38
189 0.32
190 0.29
191 0.27
192 0.27
193 0.27
194 0.33
195 0.34
196 0.36
197 0.37
198 0.43
199 0.5
200 0.55
201 0.59
202 0.59
203 0.59
204 0.64
205 0.64
206 0.62
207 0.61
208 0.58
209 0.56
210 0.51
211 0.45
212 0.38
213 0.39
214 0.34
215 0.29