Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KGE8

Protein Details
Accession K0KGE8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-41WKTPYKMSQTQKFRHRKRLQAVDKVHydrophilic
77-103KYTVFSKKSKGYRKPVHKVPKWTKLSMHydrophilic
NLS Segment(s)
PositionSequence
84-94KSKGYRKPVHK
Subcellular Location(s) mito 20.5, mito_nucl 13, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRQTTVAFGGLLWKTPYKMSQTQKFRHRKRLQAVDKVIETVFNGLKAIGESNPKVNNFYYNFPKESEMTPRDKYTVFSKKSKGYRKPVHKVPKWTKLSMRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.16
5 0.17
6 0.18
7 0.22
8 0.22
9 0.31
10 0.38
11 0.45
12 0.54
13 0.61
14 0.7
15 0.77
16 0.79
17 0.81
18 0.81
19 0.8
20 0.81
21 0.83
22 0.81
23 0.8
24 0.76
25 0.69
26 0.61
27 0.53
28 0.43
29 0.32
30 0.24
31 0.17
32 0.13
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.09
41 0.09
42 0.12
43 0.15
44 0.15
45 0.17
46 0.16
47 0.2
48 0.2
49 0.24
50 0.28
51 0.29
52 0.3
53 0.29
54 0.31
55 0.27
56 0.27
57 0.31
58 0.28
59 0.3
60 0.31
61 0.32
62 0.32
63 0.31
64 0.31
65 0.32
66 0.38
67 0.37
68 0.41
69 0.45
70 0.51
71 0.6
72 0.68
73 0.68
74 0.69
75 0.75
76 0.8
77 0.84
78 0.86
79 0.88
80 0.85
81 0.87
82 0.86
83 0.86
84 0.82
85 0.79
86 0.76
87 0.75
88 0.77
89 0.76
90 0.77