Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KS62

Protein Details
Accession K0KS62    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGSRSKRTIRRNGRQLEKSIREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0045324  P:late endosome to vacuole transport  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGSRSKRTIRRNGRQLEKSIREISALEKKTETLIKSSARKEDNKAVKIYAKELYGIKKQKSRLHKSKAQLDSVGMQIDESFGMLKLQENMKLSSGIMKEVNSLVKLPELTGTMRDLSQELVKSGIINEMVGDTVDLLDENDELEDEEVDEEVNKIISDLTKDKFNKIDNAPDTKLETPQVEEPAVEEDEDDEQVLNEMRERLKALQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.78
5 0.73
6 0.67
7 0.57
8 0.48
9 0.42
10 0.4
11 0.4
12 0.36
13 0.31
14 0.28
15 0.28
16 0.31
17 0.35
18 0.3
19 0.24
20 0.27
21 0.32
22 0.38
23 0.42
24 0.45
25 0.47
26 0.49
27 0.52
28 0.56
29 0.59
30 0.56
31 0.54
32 0.49
33 0.49
34 0.46
35 0.43
36 0.36
37 0.27
38 0.25
39 0.26
40 0.28
41 0.32
42 0.37
43 0.38
44 0.41
45 0.47
46 0.52
47 0.6
48 0.65
49 0.67
50 0.69
51 0.72
52 0.74
53 0.77
54 0.75
55 0.67
56 0.57
57 0.48
58 0.41
59 0.35
60 0.28
61 0.17
62 0.12
63 0.09
64 0.08
65 0.07
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.07
73 0.08
74 0.11
75 0.13
76 0.13
77 0.14
78 0.14
79 0.14
80 0.16
81 0.15
82 0.14
83 0.13
84 0.12
85 0.12
86 0.12
87 0.13
88 0.09
89 0.09
90 0.08
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.1
105 0.09
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.09
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.03
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.06
144 0.1
145 0.14
146 0.15
147 0.24
148 0.25
149 0.28
150 0.32
151 0.35
152 0.38
153 0.38
154 0.46
155 0.42
156 0.48
157 0.47
158 0.44
159 0.46
160 0.39
161 0.38
162 0.32
163 0.28
164 0.25
165 0.27
166 0.28
167 0.23
168 0.22
169 0.2
170 0.21
171 0.2
172 0.17
173 0.13
174 0.11
175 0.12
176 0.13
177 0.12
178 0.08
179 0.08
180 0.09
181 0.11
182 0.1
183 0.11
184 0.14
185 0.15
186 0.17
187 0.21