Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KU13

Protein Details
Accession K0KU13    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTNDTKRQKRSDRKPLILNFFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036661  Luciferase-like_sf  
Gene Ontology GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
CDD cd00347  Flavin_utilizing_monoxygenases  
Amino Acid Sequences MTNDTKRQKRSDRKPLILNFFEHAGPSQMKPGIFAHPKDESTTYKDIEYWIKLAKLAERGKINSLFIGDTLSPYDVYEGPESVKNTAINAVQFPTNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.75
5 0.66
6 0.56
7 0.47
8 0.39
9 0.31
10 0.23
11 0.17
12 0.16
13 0.14
14 0.16
15 0.16
16 0.16
17 0.18
18 0.19
19 0.23
20 0.25
21 0.26
22 0.27
23 0.27
24 0.28
25 0.28
26 0.29
27 0.23
28 0.25
29 0.27
30 0.23
31 0.21
32 0.2
33 0.2
34 0.19
35 0.18
36 0.14
37 0.13
38 0.12
39 0.13
40 0.13
41 0.13
42 0.19
43 0.2
44 0.23
45 0.25
46 0.26
47 0.29
48 0.3
49 0.29
50 0.21
51 0.2
52 0.16
53 0.13
54 0.14
55 0.1
56 0.09
57 0.1
58 0.1
59 0.09
60 0.09
61 0.11
62 0.1
63 0.12
64 0.13
65 0.12
66 0.14
67 0.18
68 0.19
69 0.18
70 0.21
71 0.19
72 0.18
73 0.21
74 0.21
75 0.19
76 0.19
77 0.2