Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KRF3

Protein Details
Accession K0KRF3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
60-85KLSTKHSPPKIPKKPKHLNDSKWSSFHydrophilic
NLS Segment(s)
PositionSequence
67-75PPKIPKKPK
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
Gene Ontology GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
Amino Acid Sequences MENISQFLTFVKNYGVPEDEVFQTIDLYESNDPTIVLQTIVSFSRYVHKNQQSIPVIGPKLSTKHSPPKIPKKPKHLNDSKWSSFEYGYIGGANQSNEKVTFGTKRNITKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.19
5 0.21
6 0.19
7 0.17
8 0.17
9 0.14
10 0.12
11 0.11
12 0.1
13 0.07
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.1
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.08
28 0.08
29 0.07
30 0.07
31 0.15
32 0.16
33 0.2
34 0.27
35 0.32
36 0.35
37 0.36
38 0.44
39 0.4
40 0.39
41 0.37
42 0.31
43 0.26
44 0.23
45 0.22
46 0.15
47 0.14
48 0.15
49 0.17
50 0.18
51 0.28
52 0.33
53 0.41
54 0.49
55 0.59
56 0.68
57 0.76
58 0.79
59 0.8
60 0.85
61 0.85
62 0.86
63 0.84
64 0.81
65 0.8
66 0.81
67 0.74
68 0.65
69 0.58
70 0.49
71 0.4
72 0.33
73 0.25
74 0.17
75 0.14
76 0.12
77 0.11
78 0.11
79 0.12
80 0.13
81 0.12
82 0.12
83 0.13
84 0.13
85 0.14
86 0.14
87 0.16
88 0.22
89 0.25
90 0.33
91 0.38